KEGG   Homo sapiens (human): 56886Help
Entry
56886             CDS       T01001                                 

Gene name
UGGT1, HUGT1, UGCGL1, UGT1
Definition
UDP-glucose glycoprotein glucosyltransferase 1
Orthology
K11718  
UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56886 (UGGT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     56886 (UGGT1)
Glycosyltransferases [BR:hsa01003]
 Others
  Quality control
   56886 (UGGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q14.3
AA seq 1555 aa AA seqDB search
MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPL
LLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKF
CLSLRSYSATIQAFQQIAADEPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLF
KGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRDLHPDLEGQ
LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAI
TKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAQEVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYV
EVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKIL
ETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDY
ARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE
ALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRII
GPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKG
DPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRV
FMNCQSKLSDMPLKSFYRYVLEPEISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESW
MVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANP
VIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADEVVIVLNNF
KSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFS
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYK
WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPY
GYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQG
LSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
PKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
NT seq 4668 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaagggagacgcgagcggtgcgtgtgccgcgggtgcgctgccggtgacagga
gtttgctataaaatgggagttctggttgtactcactgttctgtggctgttctcctcagta
aaggccgactcaaaagccattacaacctctcttacaacaaaatggttttccactccattg
ttgttagaagccagtgagtttttagcagaagacagtcaagagaaattttggaattttgta
gaagccagtcaaaatattggatcatcagatcatgacggtaccgattattcctactatcat
gcaatattggaggctgcatttcagtttctgtcacccctccagcagaatttgtttaaattt
tgtctgtcccttcgttcttactcagctacaatccaagccttccagcagatagcagctgat
gaacctccaccagaaggatgtaattcgtttttttcagtgcatggaaagaagacttgtgaa
tctgatacccttgaggctcttctactgacagcctctgaaagacccaaacctttattgttc
aaaggagatcacagatatccctcgtctaatcctgaaagccctgtggtgattttctactct
gagattggctctgaggaattttccaattttcaccgccagcttatatcaaaaagcaatgca
ggcaaaatcaattatgtattcagacattatatatttaatcccaggaaggagcctgtttac
ctctctggctatggcgtggaattggccattaagagcactgagtacaaggccaaggatgat
actcaggtgaaaggaactgaggtaaacaccacagtgattggtgaaaatgatcctattgat
gaggttcaggggttcctctttggaaaattaagagatctgcaccccgacctggagggacag
ttgaaagaactcagaaagcatcttgtagagagcaccaatgaaatggcacctttaaaggtt
tggcagttgcaagatctcagtttccagactgctgctcgaatcttggcttctcctgttgag
ttggctttggttgtcatgaaggatcttagtcagaattttcctaccaaagccagagcaata
acaaaaacagctgtgagctcagaacttagaaccgaagtggaagagaatcagaagtatttc
aagggaactttaggattacaacctggagattcagccctcttcatcaatggacttcacatg
gatttagatacacaggatatattcagtctgtttgatgtgttgaggaatgaagctcgggta
atggagggtctgcatagattgggaatagaaggcctttctctgcataatgttttgaagctg
aacatccagccctctgaggcagactatgccgtagacatccggagtcctgctatttcatgg
gtcaacaacctggaggttgatagcagatataattcgtggccttctagtttacaagagttg
cttcgacccacctttcctggtgttattcggcagatcaggaaaaacttacataatatggtt
ttcatagttgatcctgcacatgagaccacagcagagttgatgaacacagctgagatgttc
cttagtaatcatataccactaagaattggttttatctttgtggttaatgactctgaagat
gttgatgggatgcaagatgctggagtggctgttcttagagcatataattatgttgcccaa
gaagtggatgattatcatgccttccagactctgacacatatctataacaaggtgaggact
ggagaaaaagtgaaagttgaacatgtggtcagtgtcctggagaagaaatatccgtatgta
gaagtgaatagcattttggggattgattctgcttatgatcggaatcggaaggaagcaaga
ggctactatgagcagactggagttggacctctgcccgttgtgctgttcaatggaatgccc
tttgaaagggaacagctagaccctgatgagttagaaaccatcacaatgcataaaatcctg
gagaccaccaccttcttccaaagagcggtgtacttgggtgaactgccccatgatcaagat
gtggtagagtatatcatgaatcagccaaatgttgttccacgaatcaattctaggattttg
acagctgaacgagactacctggatttaacagcgagtaataacttctttgtggatgattat
gctagatttactatcttggattcccaaggcaagactgctgctgtagccaatagtatgaac
tatctgacaaagaaaggaatgtcctccaaggaaatctatgatgattcttttattaggcca
gtaactttttggattgttggggattttgatagcccttctggacggcagttactgtatgat
gccatcaaacatcagaaatccagtaacaatgttagaataagcatgatcaataatcctgcc
aaagagataagctatgagaacactcagatctccagagcaatctgggcagctctccaaact
cagacttccaacgctgctaagaacttcatcaccaaaatggccaaggagggggctgcagag
gccctggctgcaggagctgacattgcggagttctctgttgggggaatggatttcagtctt
tttaaagaggtctttgagtcttccaaaatggatttcattttgtctcatgccgtgtactgc
agggatgttctgaagctgaagaagggacagagggcagtgatcagcaatggaaggatcatt
gggccactggaggatagtgagctctttaatcaagacgatttccacctcctcgaaaatatc
atcttaaaaacctcaggacagaaaataaaatctcatattcaacagcttcgggtagaagaa
gatgtggcaagcgacttggtaatgaaggtggatgctcttctgtcagcgcaaccaaaagga
gatccaagaatcgagtaccagttttttgaagacagacacagtgcaatcaaactgaggccg
aaggaaggggagacatactttgatgttgtggctgtcgttgaccctgtcaccagagaagca
cagagacttgctcctttgctcttggttttggctcagctgataaacatgaatctgagagta
tttatgaactgccaatccaaactttctgacatgcctttaaaaagcttttaccgttatgtc
ttagaaccagagatttctttcacttcagacaatagttttgctaagggtccaatcgcaaaa
tttttggatatgcctcagtctccactgttcactctgaatttgaacacacctgagagctgg
atggtagaatctgtcagaacaccatatgatcttgataatatttatttagaagaggtggac
agtgtagtggctgctgagtatgagctggaatacctgttactggaaggtcattgctacgac
atcaccacaggccagcctccacggggactacagtttaccttaggaacttcagccaacccg
gtcattgtggacaccattgttatggccaatctgggctactttcagctgaaagccaaccca
ggagcttggatcctcagacttaggaagggacgctctgaagatatttatagaatttacagc
cacgatggcactgattctccccctgatgctgatgaggtggttatcgtcctcaacaacttc
aaaagcaaaattattaaagtgaaggttcagaagaaggcagatatggtgaacgaagacttg
ctgagtgatggaacgagtgagaatgaatctggattttgggattccttcaaatggggcttt
acaggacagaagactgaggaagtgaagcaagataaagatgacataattaatattttctcc
gttgcatctggtcatctctacgaaagatttcttcgcataatgatgctatccgtgctgaag
aataccaagactcctgtgaaattctggttcttgaagaattacttgtcccccacatttaag
gagtttataccttacatggcaaatgaatacaatttccagtatgagcttgttcagtacaaa
tggccccggtggcttcatcaacaaactgaaaaacagcgtatcatctggggttacaagatc
ctcttcctggatgtacttttcccactagttgttgacaagttcctgtttgtggatgctgat
cagattgtacgaacagatctgaaagagttaagagatttcaatttggatggtgctccttat
ggttacactcctttctgtgacagccgaagagaaatggacggctacaggttctggaagtca
gggtactgggccagtcatttagccgggcgaaagtatcatatcagtgcactatatgttgtg
gatctgaagaagtttaggaaaatagctgctggtgacagactcaggggacagtaccaaggt
ctgagtcaggaccctaacagcctttcaaatcttgatcaagatctgcccaataacatgatt
catcaggtgccaattaaatccctccctcaagaatggctttggtgtgaaacgtggtgtgat
gacgcctctaagaaaagggcaaaaaccattgatttgtgtaataatccgatgaccaaagag
ccgaaactggaagcagctgtgcggattgtcccggagtggcaggactacgaccaagagatc
aaacagctacagatccgctttcagaaggagaaagaaacgggagcactgtacaaagagaag
acaaaagaaccaagccgagaaggtcctcagaaacgtgaagaattatga

DBGET integrated database retrieval system