KEGG   Homo sapiens (human): 56898Help
Entry
56898             CDS       T01001                                 

Gene name
BDH2, DHRS6, EFA6R, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    56898 (BDH2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    56898 (BDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     56898 (BDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaagtcatcatcctgacggccgctgctcaggggattggccaa
gcagctgccttagcttttgcaagagaaggtgccaaagtcatagccacagacattaatgag
tccaaacttcaggaactggaaaagtacccgggtattcaaactcgtgtccttgatgtcaca
aagaagaaacaaattgatcagtttgccaatgaagttgagagacttgatgttctctttaat
gttgctggttttgtccatcatggaactgtcctggattgtgaggagaaagactgggacttc
tcgatgaatctcaatgtgcgcagcatgtacctgatgatcaaggcattccttcctaaaatg
cttgctcagaaatctggcaatattatcaacatgtcttctgtggcttccagcgtcaaagga
gttgtgaacagatgtgtgtacagcacaaccaaggcagccgtgattggcctcacaaaatct
gtggctgcagatttcatccagcagggcatcaggtgcaactgtgtgtgcccaggaacagtt
gatacgccatctctacaagaaagaatacaagccagaggaaatcctgaagaggcacggaat
gatttcctgaagagacaaaagacgggaagattcgcaactgcagaagaaatagccatgctc
tgcgtgtatttggcttctgatgaatctgcttatgtaactggtaaccctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system