KEGG   Homo sapiens (human): 56898Help
Entry
56898             CDS       T01001                                 

Gene name
BDH2, DHRS6, EFA6R, PRO20933, SDR15C1, UCPA-OR, UNQ6308
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hsa00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q24
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaagtcatcatcctgacggccgctgctcaggggattggccaa
gcagctgccttagcttttgcaagagaaggtgccaaagtcatagccacagacattaatgag
tccaaacttcaggaactggaaaagtacccgggtattcaaactcgtgtccttgatgtcaca
aagaagaaacaaattgatcagtttgccaatgaagttgagagacttgatgttctctttaat
gttgctggttttgtccatcatggaactgtcctggattgtgaggagaaagactgggacttc
tcgatgaatctcaatgtgcgcagcatgtacctgatgatcaaggcattccttcctaaaatg
cttgctcagaaatctggcaatattatcaacatgtcttctgtggcttccagcgtcaaagga
gttgtgaacagatgtgtgtacagcacaaccaaggcagccgtgattggcctcacaaaatct
gtggctgcagatttcatccagcagggcatcaggtgcaactgtgtgtgcccaggaacagtt
gatacgccatctctacaagaaagaatacaagccagaggaaatcctgaagaggcacggaat
gatttcctgaagagacaaaagacgggaagattcgcaactgcagaagaaatagccatgctc
tgcgtgtatttggcttctgatgaatctgcttatgtaactggtaaccctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system