KEGG   Homo sapiens (human): 56899Help
Entry
56899             CDS       T01001                                 

Gene name
ANKS1B, AIDA, AIDA-1, ANKS2, EB-1, EB1, cajalin-2
Definition
(RefSeq) ankyrin repeat and sterile alpha motif domain containing 1B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q23.1
AA seq 1248 aa AA seqDB search
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSTVLEEPVQE
DATQETHISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP
MLAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLMDTAVTKKPCSLEIARAPSPRTD
NASEVAVTTPGTSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHR
MNHNQEYFEINTSTGCTSFTASPPASPPTSSVGTTEVKNEGTNHTDDLSRQDDNDPPKEY
DPGQFAGLLHGSSPACESPENPFHLYGKREQCEKGQDEVSLANSPLPFKQSPIENNSEPL
VKKIKPKVVSRTIFHKKSNQLENHTIVGTRSTRSGSRNGDQWVMNAGGFVERACTLGRIR
SLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKGNSERTPSFTSEW
EEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGD
YTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSIT
LREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQM
AQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDP
EDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSST
LPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggaccaggagctgctggaagctgctcgcactggaaatgtggctctggtggag
aaactcctgtctggcaggaaaggagggatcctgggcggtggatccggacccctgcccctg
tctaatctgctaagcatctggcgaggccccaatgtgaactgcacagacagttcgggttac
actgctttacaccacgcagccttaaatggacataaggacatagttctcaaactacttcag
tatgaggcatcaacaaatgtagcagacaacaaagggtattttcctattcacctggctgcc
tggaaaggagatgtggaaattgtgaagattcttattcatcatggaccatcacattccagg
gtcaatgaacagaacaatgaaaatgaaactgccctacactgtgcagctcaatatggacac
tcagaagtagttgctgttctcctagaagagctcactgacccgacaattagaaatagcaag
ctggaaacacctttggacttggcggcactctacggacggcttagagtggtaaaaatgatc
atcagtgcacatcctaacttaatgagctgcaacactcgcaagcacacgccacttcacctt
gctgcgcgcaatggccacaaagcagtcgtgcaggtgctgctggaggcaggaatggatgtg
agctgtcaaacagaaaaggggagtgcacttcatgaagcagctttgtttggaaaggtggat
gttgtacgagttctgttagaaacaggaattgatgccaacataaaggatagcttaggtaga
actgtcttggacattctgaaagaacatccatctcagaaatctctccagattgcaacactc
ttacaagagtatttagaaggcgtgggaagatctacagtcctcgaagagcctgtacaggaa
gatgcaacacaagaaacacacatttcatctcctgttgagtctccttcccaaaagaccaaa
agtgaaaccgtcactggagaattatcaaaactcttggatgaaataaaactctgtcaagaa
aaggattattcgtttgaagacttgtgccacacaatatcagaccactacttagataatttg
agcaagatttcagaggaagaacttgggaaaaatggaagccagagtgtaagaacctcatct
acaatcaatttgtcaccaggagaagtggaagaagaggatgatgatgaaaatacgtgtggg
ccatcaggactttgggaagcattaactccgtgtaatggatgtaggaaccttggcttcccc
atgcttgcccaggagtcctatccaaagaagagaaattacactatggaaattgtaccatct
gcttctctggatacatttccttcagaaaatgagaactttctgtgtgatctcatggacaca
gctgttacaaagaaaccttgctccttagaaattgcaagggcaccttccccaagaactgat
aatgcctctgaggtagcagttactactccaggaactagtaaccatagaaacagctcaaca
ggcccaacacctgattgttcacctccatcccctgatactgccctcaaaaatattgtaaaa
gtcattcgaccccagcctaaacagcgaacatccattgtgtcttctctggattttcaccga
atgaatcacaaccaagaatattttgaaatcaacacatctacagggtgcacaagctttact
gccagtcctcctgctagtccacccacctcttctgtgggaaccacagaagtcaagaatgag
ggaactaaccatacagatgacctctcccgacaggatgacaatgatcccccaaaagaatat
gatcctgggcaatttgcaggcctgctccatggatcctctccagcctgtgagtcccctgaa
aatccatttcatctctatgggaaaagagaacaatgtgaaaaaggacaagatgaagtcagt
ttggcaaacagtcctttgcctttcaagcagtctccaatagaaaataactcagaacctttg
gtaaagaaaattaaacccaaagtggtcagtagaacaatttttcacaaaaaaagcaaccaa
ctcgaaaaccataccattgttggcacaagatcaaccaggagtggatctcggaatggggac
cagtgggttatgaacgcagggggatttgtggagagagcctgtactctggggagaataagg
tcattgcctaaagccttgatcgacatgcatttgtcaaaaagtgtctctaaatctgattct
gatctcattgcctatccttccaatgagaaaacatcaagagttaactggagtgaatcttcc
actgctgaacacagttctaaagggaattctgaaagaacaccatccttcacatcggaatgg
gaagaaattgacaaaataatgagttccatagatgttggaatcaacaacgaacttaaagag
atgaatggtgagaccacaagacccagatgccctgtccaaacagtgggacaatggttggaa
agcattgggctacctcagtacgagaaccacctgatggctaatggatttgacaatgtgcag
tttatgggaagcaatgttatggaagatcaggatttgttggaaattggaatccttaattct
gggcacagacaaagaattctacaggcaatccagctccttccaaagatgagacccattggg
catgatggctaccatcccacctctgtagctgagtggctggattccattgaactgggcgac
tacaccaaagcctttctaattaatggctacacttcgatggacctgttgaaaaaaatctgg
gaggttgaacttattaatgttttaaaaatcaatttgattggccacaggaaacgtattttg
gcatctctgggagacaggctgcacgacgatcccccacagaagccccctcggtccatcacc
ctcagggaacccagtggtaatcacactcctcctcagttgtctccatcacttagccaaagc
acttacaccactggtggctccctagacgttcctcacattatcatgcagggcgatgcaagg
aggagaagaaatgaaaactactttgatgatattccccgatcaaaactggagaggcagatg
gctcagacaggagactggggagaaccttccattaccttgcgacctccgaatgaagccaca
gcctctaccccggtacagtactggcagcatcacccagaaaagcttatcttccagtcgtgt
gattacaaagctttttatttaggttctatgctgataaaagagcttagggggacagaatca
acccaagatgcttgtgcaaaaatgcgggctaactgtcagaagtctacagagcaaatgaag
aaggtccctactattattctttctgtctcatataaaggagtcaaatttattgatgcaaca
aataagaacataattgctgagcatgaaattcgtaatatctcctgtgctgcccaggaccca
gaagacctctcaacatttgcctatatcacaaaagatttgaagtctaatcaccactactgt
catgtgtttactgcctttgatgtgaatttagcctatgaaatcatcctaaccctgggacag
gcattcgaagtcgcttaccagctagcactacaagcaagaaaagggggacactcctccaca
cttccagaaagctttgaaaacaaaccctccaaacccatccccaagccccgcgttagcatt
cgcaagtccgtggatcttcttcatgccagccataccgggcaggaaccatcagagagacac
actgaggaggcactcagaaaattttga

DBGET integrated database retrieval system