KEGG   Homo sapiens (human): 56904Help
Entry
56904             CDS       T01001                                 

Gene name
SH3GLB2, PP6569, PP9455, RRIG1
Definition
(RefSeq) SH3 domain containing GRB2 like, endophilin B2
  KO
K21269  
endophilin-B2
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    56904 (SH3GLB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    56904 (SH3GLB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NR46(Tdark)
UniProt: 
Position
9q34.11
AA seq 395 aa AA seqDB search
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAE
AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLE
GISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTS
PTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADE
LITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaacatgaagaagctggcgtcggacgcgggcatcttcttcacccgggcggtg
cagttcacggaggagaaatttggccaggctgagaagactgagcttgatgcccactttgaa
aaccttctggcccgggcagacagcaccaagaactggacagagaagatcttgaggcagaca
gaggtgctgctgcagcccaaccccagtgcccgagtggaggagttcctgtatgagaagctg
gacaggaaggtcccctcaagggtcaccaacggggagctgctggctcagtacatggcagac
gcggccagtgagctggggccgaccaccccctatgggaagacactgatcaaggtggcagaa
gctgaaaagcaactgggagccgcggagagggattttatccacacggcctccatcagcttc
ctcacacccttgcgcaacttcctggagggggactggaagaccatctcgaaggagaggcgg
ctcctccaaaaccggcgtctggacttggatgcctgcaaagcgaggctgaagaaggccaag
gctgcagaagccaaagccacgacggtgcctgactttcaggagactagacctcgtaattac
attctctcggccagcgcctccgcgctctggaatgatgaagtggacaaggccgagcaggag
ctccgcgtggcccagacagagtttgaccggcaagcagaagtgacccgtctcttgctggag
ggaatcagtagcactcacgtgaaccacctgcgctgcctccacgagttcgtcaagtctcag
acaacctactacgcacagtgctaccgccacatgctggacttgcagaagcagctgggcaga
tttcccggcaccttcgtgggcaccacagagcccgcctccccacccctgagcagcacctca
cccaccactgctgcggccactatgcctgtggtgccctctgtggccagcctggcccctccg
ggggaggcctcgctctgcctggaagaggtggccccccctgccagtgggacccgcaaagct
cgggtgctctatgactacgaggcagccgacagcagtgagctggccctgctggctgatgag
ctcatcactgtctacagcctgcctggcatggaccctgactggctcattggcgagagaggc
aacaagaagggcaaggtccctgtcacctacttggaactgctcagctag

DBGET integrated database retrieval system