KEGG   Homo sapiens (human): 56904Help
Entry
56904             CDS       T01001                                 

Gene name
SH3GLB2, PP6569, PP9455, RRIG1
Definition
SH3-domain GRB2-like endophilin B2
Orthology
K11248  
endophilin-B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    56904 (SH3GLB2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56904 (SH3GLB2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    56904 (SH3GLB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 404 aa AA seqDB search
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAE
AEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATCEGDTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTR
LLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGSSQGAIFPGTFVGTTEP
ASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADS
SELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaacatgaagaagctggcgtcggacgcgggcatcttcttcacccgggcggtg
cagttcacggaggagaaatttggccaggctgagaagactgagcttgatgcccactttgaa
aaccttctggcccgggcagacagcaccaagaactggacagagaagatcttgaggcagaca
gaggtgctgctgcagcccaaccccagtgcccgagtggaggagttcctgtatgagaagctg
gacaggaaggtcccctcaagggtcaccaacggggagctgctggctcagtacatggcagac
gcggccagtgagctggggccgaccaccccctatgggaagacactgatcaaggtggcagaa
gctgaaaagcaactgggagccgcggagagggattttatccacacggcctccatcagcttc
ctcacacccttgcgcaacttcctggagggggactggaagaccatctcgaaggagaggcgg
ctcctccaaaaccggcgtctggacttggatgcctgcaaagcgaggctgaagaaggccaag
gctgcagaagccaaagccacgtgtgagggagatacggtgcctgactttcaggagactaga
cctcgtaattacattctctcggccagcgcctccgcgctctggaatgatgaagtggacaag
gccgagcaggagctccgcgtggcccagacagagtttgaccggcaagcagaagtgacccgt
ctcttgctggagggaatcagtagcactcacgtgaaccacctgcgctgcctccacgagttc
gtcaagtctcagacaacctactacgcacagtgctaccgccacatgctggacttgcagaag
cagctgggcagctcccagggtgccatatttcccggcaccttcgtgggcaccacagagccc
gcctccccacccctgagcagcacctcacccaccactgctgcggccactatgcctgtggtg
ccctctgtggccagcctggcccctccgggggaggcctcgctctgcctggaagaggtggcc
ccccctgccagtgggacccgcaaagctcgggtgctctatgactacgaggcagccgacagc
agtgagctggccctgctggctgatgagctcatcactgtctacagcctgcctggcatggac
cctgactggctcattggcgagagaggcaacaagaagggcaaggtccctgtcacctacttg
gaactgctcagctag

DBGET integrated database retrieval system