KEGG   Homo sapiens (human): 56907Help
Entry
56907             CDS       T01001                                 

Gene name
SPIRE1, Spir-1
Definition
spire-type actin nucleation factor 1
Orthology
K02098  
spire
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    56907 (SPIRE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.21
AA seq 756 aa AA seqDB search
MAQAAGPAGGGEPRTEAVGGEGPREPGAAGGAAGGSRDALSLEEILRLYNQPINEEQAWA
VCYQCCGSLRAAARRRQPRHRVRSAAQIRVWRDGAVTLAPAADDAGEPPPVAGKLGYSQC
METEVIESLGIIIYKALDYGLKENEERELSPPLEQLIDHMANTVEADGSNDEGYEAAEEG
LGDEDEKRKISAIRSYRDVMKLCAAHLPTESDAPNHYQAVCRALFAETMELHTFLTKIKS
AKENLKKIQEMEKSDESSTDLEELKNADWARFWVQVMRDLRNGVKLKKVQERQYNPLPIE
YQLTPYEMLMDDIRCKRYTLRKVMVNGDIPPRLKKSAHEIILDFIRSRPPLNPVSARKLK
PTPPRPRSLHERILEEIKAERKLRPVSPEEIRRSRLAMRPLSMSYSFDLSDVTTPESTKN
LVESSMVNGGLTSQTKENGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHKSTSSSS
VSPSFPEEPVLEAVSTRKKPPKFLPISSTPQPERRQPPQRRHSIEKETPTNVRQFLPPSR
QSSRSLEEFCYPVECLALTVEEVMHIRQVLVKAELEKYQQYKDIYTALKKGKLCFCCRTR
RFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPST
AHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSL
VLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcggctggcccggcgggcggcggggagccgcggactgaggcagtgggcggc
gaggggccgcgggagcccggggcagccggcggcgcggccgggggctcccgggacgcgctg
agcctggaggagatcctgcggctgtacaaccagcccatcaacgaggagcaggcgtgggcc
gtgtgctaccagtgctgcggttccctgcgcgccgccgcccgccgccgccagccccgccac
cgtgtgcgctcggccgcgcagatccgcgtctggagggacggcgccgtcaccctggcgccc
gcggccgacgacgcgggagagccgcccccagttgcgggtaaattgggatattcacaatgt
atggaaacagaggtcattgaatctttgggaattattatttataaagcactggactatggt
ttgaaggagaatgaagaaagggaattaagccctcccctagagcagcttatcgatcacatg
gccaacacggtggaagctgacggtagcaatgatgagggctatgaggctgcagaagaaggc
ctgggagatgaagatgaaaagagaaaaatctcagctattcggtcatatagagatgtcatg
aagttgtgtgctgctcatctccctactgaatcagatgcaccaaatcattatcaggcagta
tgtcgtgcactgtttgcagaaacaatggagctccatacatttctgaccaaaattaagagt
gcgaaagagaatcttaagaagattcaagaaatggaaaagagcgatgaatctagcacagac
ttggaagagctgaaaaacgctgactgggcacgattctgggtacaggtgatgagggatttg
aggaatggggtaaaacttaagaaggtccaagagcggcagtacaaccctttgcccattgaa
tatcagctcaccccttatgagatgttaatggatgacattcgctgcaaaagatacaccttg
cgaaaagtgatggtgaatggtgatattccccctcggttaaaaaagagtgctcatgaaatc
atcctcgacttcatcagatccagacctcctttaaatccagtctcagccagaaaactgaaa
ccaactccaccacggccacggagcctccatgaaagaatattagaagaaattaaagcagaa
agaaagctgcggcctgtatcaccagaggagattagacgtagcagattagcaatgcggcca
cttagcatgtcttacagttttgacttgtcagatgtgactacccctgaatctacaaagaat
cttgtggagtcatctatggtgaatggaggtttgacatcacaaacaaaagaaaacgggtta
agtacctcacagcaggtgcctgcacagcggaagaagctcctcagagccccaactctggcc
gaactggacagctctgagtctgaggaagaaacgctgcacaagtcgaccagcagcagcagc
gtgtctccctctttccctgaagagccagtcctggaggccgtgtccacaaggaagaagcct
ccaaaattcctgcccatatcatcaacaccccagccagagagacggcagccaccccagaga
cgacattccattgaaaaggaaacgcctactaacgtgaggcagttcctgccgccttccagg
cagagttcccgctctcttgaggaattctgctacccagtggaatgcctcgctcttactgtg
gaagaagtgatgcatattcgccaggtcctggtgaaggcagagctggaaaaataccaacag
tataaagacatctacaccgccttgaaaaaaggaaagctctgcttttgttgccgaaccagg
aggttttccttcttcacttggtcttatacctgtcagttctgtaagaggccggtgtgctca
cagtgttgcaaaaagatgcggctgccctccaaaccatactccactcttcctatcttttca
ttgggaccttctgctctgcaaagaggggaaagtagtatgaggtcagaaaaaccctccact
gcccatcatcggccacttcggagcattgccaggttctcctcaaaatctaagtctatggac
aaatcagatgaagaactccagtttcccaaagagttgatggaggactggagcaccatggag
gtgtgtgtggactgcaagaagttcatttcggaaatcatcagttcaagccggcgcagtctg
gtgttggccaacaaaagggcccgattgaaaaggaaaacgcagtctttctacatgtcctcg
ccaggcccctcggagtactgcccttcagagaggacgatcagtgagatctga

DBGET integrated database retrieval system