KEGG   Homo sapiens (human): 56913Help
Entry
56913             CDS       T01001                                 

Gene name
C1GALT1, C1GALT, T-synthase
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00512  Mucin type O-glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    56913 (C1GALT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  N-acetylgalactosaminide beta-1,3-galactosyltransferase
     56913 (C1GALT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 3 chain
   56913 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 56913
NCBI-ProteinID: NP_064541
OMIM: 610555
HGNC: 24337
Ensembl: ENSG00000106392
Vega: OTTHUMG00000151912
Pharos: Q9NS00(Tbio)
UniProt: Q9NS00 A0A024RA32
Position
7p22.1-p21.3
AA seq 363 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLE
GQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLR
WLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKL
GNP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcctggctgaattttttaaccttcctctgtggatcagcaataggattt
cttttatgttctcagctatttagtattttgttgggagaaaaggttgacacccagcctaat
gttcttcataatgatcctcatgcaaggcattcagatgataatggacagaatcatctagaa
ggacaaatgaacttcaatgcagattctagccaacataaagatgagaacacagacattgct
gaaaacctctatcagaaagttagaattctttgctgggttatgaccggccctcaaaaccta
gagaaaaaggccaaacacgtcaaagctacttgggcccagcgttgtaacaaagtgttgttt
atgagttcagaagaaaataaagacttccctgctgtgggactgaaaaccaaagaaggcaga
gatcaactatactggaaaacaattaaagcttttcagtatgttcatgaacattatttagaa
gatgctgattggtttttgaaagcagatgatgacacgtatgtcatactagacaatttgagg
tggcttctttcaaaatacgaccctgaagaacccatttactttgggagaagatttaagcct
tatgtaaagcagggctacatgagtggaggagcaggatatgtactaagcaaagaagccttg
aaaagatttgttgatgcatttaaaacagacaagtgtacacatagttcctccattgaagac
ttagcactggggagatgcatggaaattatgaatgtagaagcaggagattccagagatacc
attggaaaagaaacttttcatccctttgtgccagaacaccatttaattaaaggttatcta
cctagaacgttttggtactggaattacaactattatcctcctgtagagggtcctggttgc
tgctctgatcttgcagtttcttttcactatgttgattctacaaccatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctaccttacct
gaacgtatactaaaggaaattagtcaagcaaacaaaaatgaagatacaaaagtgaagtta
ggaaatccttga

DBGET integrated database retrieval system