KEGG   Homo sapiens (human): 56924Help
Entry
56924             CDS       T01001                                 

Gene name
PAK6, PAK5
Definition
(RefSeq) p21 (RAC1) activated kinase 6
  KO
K05735  
p21-activated kinase 6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    56924 (PAK6)
   04012 ErbB signaling pathway
    56924 (PAK6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    56924 (PAK6)
  Cell motility
   04810 Regulation of actin cytoskeleton
    56924 (PAK6)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    56924 (PAK6)
  Development
   04360 Axon guidance
    56924 (PAK6)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    56924 (PAK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56924 (PAK6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   56924 (PAK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NQU5(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
15q15.1
AA seq 681 aa AA seqDB search
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSAMPVDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
HWATDPDMYLQSPQSERTDPHGLYLSCNGGTPAGHKQMPWPEPQSPRVLPNGLAAKAQSL
GPAEFQGASQRCLQLGACLQSSPPGASPPTGTNRHGMKAAKHGSEEARPQSCLVGSATGR
PGGEGSPSPKTRESSLKRRLFRSMFLSTAATAPPSSSKPGPPPQSKPNSSFRPPQKDNPP
SLVAKAQSLPSDQPVGTFSPLTTSDTSSPQKSLRTAPATGQLPGRSSPAGSPRTWHAQIS
TSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGI
VCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVL
MEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRV
KLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPP
YFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQ
TGLPECLVPLIQLYRKQTSTC
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcaagaaaaagaagaaacgccctgagatctcagcgccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaagtttgtgggcctccccccacaatgg
cagaacatcctggacacactgcggcgccccaagcccgtggtggacccttcgcgaatcaca
cgggtgcagctccagcccatgaagacagtggtgcggggcagcgcgatgcctgtggatggc
tacatctcggggctgctcaacgacatccagaagttgtcagtcatcagctccaacaccctg
cgtggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
cactgggccaccgacccagacatgtacctccagagcccccagtctgagcgcactgacccc
cacggcctctacctcagctgcaacgggggcacaccagcaggccacaagcagatgccgtgg
cccgagccacagagcccacgggtcctgcccaatgggctggctgcaaaggcacagtccctg
ggccccgccgagtttcagggtgcctcgcagcgctgtctgcagctgggtgcctgcctgcag
agctccccaccaggagcctcgccccccacgggcaccaataggcatggaatgaaggctgcc
aagcatggctctgaggaggcccggccacagtcctgcctggtgggctcagccacaggcagg
ccaggtggggaaggcagccctagccctaagacccgggagagcagcctgaagcgcaggcta
ttccgaagcatgttcctgtccactgctgccacagcccctccaagcagcagcaagccaggc
cctccaccacagagcaagcccaactcctctttccgaccgccgcagaaagacaacccccca
agcctggtggccaaggcccagtccttgccctcggaccagccggtggggaccttcagccct
ctgaccacttcggataccagcagcccccagaagtccctccgcacagccccggccacaggc
cagcttccaggccggtcttccccagcgggatccccccgcacctggcacgcccagatcagc
accagcaacctgtacctgccccaggaccccacggttgccaagggtgccctggctggtgag
gacacaggtgttgtgacacatgagcagttcaaggctgcgctcaggatggtggtggaccag
ggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccaccggcatc
gtctgcttggcccgggagaagcactcgggccgccaggtggccgtcaagatgatggacctc
aggaagcagcagcgcagggagctgctcttcaacgaggtggtgatcatgcgggactaccag
cacttcaacgtggtggagatgtacaagagctacctggtgggcgaggagctgtgggtgctc
atggagttcctgcagggaggagccctcacagacatcgtctcccaagtcaggctgaatgag
gagcagattgccactgtgtgtgaggctgtgctgcaggccctggcctacctgcatgctcag
ggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgatggcagggtg
aagctctcggacttcggattctgtgctcagatcagcaaagacgtccctaagaggaagtcc
ctggtgggaaccccctactggatggctcctgaagtgatctccaggtctttgtatgccact
gaggtggatatctggtctctgggcatcatggtgattgagatggtagatggggagccaccg
tacttcagtgactccccagtgcaagccatgaagaggctccgggacagccccccacccaag
ctgaaaaactctcacaaggtctccccagtgctgcgagacttcctggagcggatgctggtg
cgggacccccaagagagagccacagcccaggagctcctagaccaccccttcctgctgcag
acagggctacctgagtgcctggtgcccctgatccagctctaccgaaagcagacctccacc
tgctga

DBGET integrated database retrieval system