KEGG   Homo sapiens (human): 56925Help
Entry
56925             CDS       T01001                                 

Gene name
LXN, ECI, TCI
Definition
(RefSeq) latexin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BS40(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.32
AA seq 222 aa AA seqDB search
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE
IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQ
NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcccgccgaccaactacccagcctccagggcggccttggtggcacagaactac
atcaactaccagcaggggaccccgcacagggtgtttgaggtgcagaaggtcaaacaagcc
agcatggaggatattccaggaagaggacataagtatcaccttaaatttgctgttgaagaa
attatacaaaaacaagttaaggtgaactgcacagctgaagtactttacccttcaacggga
caagaaactgcaccagaagtcaacttcacatttgaaggagaaactggaaagaatccagat
gaagaagacaacacattttatcaaagacttaagtccatgaaggaaccgctagaagcacaa
aatattccagacaattttggaaatgtatctccagaaatgacgctcgttctacatttagcc
tgggttgcctgtggttatataatatggcaaaattctactgaagacacatggtataaaatg
gtaaaaattcaaactgtcaagcaagtgcaaagaaatgatgactttattgaattagactac
accattctacttcataatatagcatctcaggagattattccctggcaaatgcaagttctc
tggcatccacaatacggcactaaagtaaaacataatagccgtctgccaaaggaagtacaa
ctggaataa

DBGET integrated database retrieval system