KEGG   Homo sapiens (human): 56940Help
Entry
56940             CDS       T01001                                 

Gene name
DUSP22, JKAP, JSP-1, JSP1, LMW-DSP2, LMWDSP2, MKP-x, MKPX, VHX
Definition
dual specificity phosphatase 22 (EC:3.1.3.16 3.1.3.48)
Orthology
K14165  
atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     56940 (DUSP22)
    3.1.3.48  protein-tyrosine-phosphatase
     56940 (DUSP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25.3
AA seq 205 aa AA seqDB search
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPS
QNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRA
GRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILGKYKEQGRTEP
QPGARRWSSFPALAPLTYDNYTTET
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgggatgaacaagatcctgcccggcctgtacatcggcaacttcaaagatgcc
agagacgcggaacaattgagcaagaacaaggtgacacatattctgtctgtccacgatagt
gccaggcctatgttggagggagttaaatacctgtgcatcccagcagcggattcaccatct
caaaacctgacaagacatttcaaagaaagtattaaattcattcacgagtgccggctccgc
ggtgagagctgccttgtacactgcctggccggggtctccaggagcgtgacactggtgatc
gcatacatcatgaccgtcactgactttggctgggaggatgccctgcacaccgtgcgtgct
gggagatcctgtgccaaccccaacgtgggcttccagagacagctccaggagtttgagaag
catgaggtccatcagtatcggcagtggctgaaggaagaatatggagagagccctttgcag
gatgcagaagaagccaaaaacattctgggtaaatataaggagcaagggcgcacagagccc
cagcccggcgccaggcggtggagcagttttccggcactggctccgctgacctacgataat
tatacgacggagacctaa

DBGET integrated database retrieval system