KEGG   Homo sapiens (human): 56945Help
Entry
56945             CDS       T01001                                 

Gene name
MRPS22, C3orf5, COXPD5, GIBT, MRP-S22, RPMS22
Definition
mitochondrial ribosomal protein S22
Orthology
K17401  
small subunit ribosomal protein S22, mitochondrial
Organism
hsa  Homo sapiens (human)
Disease
H00891  
Combined oxidative phosphorylation deficiency (COXPD)
Brite
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    56945 (MRPS22)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    56945 (MRPS22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q23
AA seq 360 aa AA seqDB search
MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGGLLQPLPCSFEMGLPRRRFSSEAAES
GSPETKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVE
AAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGT
LRKASWEERDRMIQVYFPKEGRKILTPIIFKEENLRTMYSQDRHVDVLNLCFAQFEPDST
EYIKVHHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKKIDGLLIDQIQRDLIDDATNL
VQLYHVLHPDGQSAQGAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQEALSRHSAAS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccctcggaacaactgtattgctgtggagcctcttgaggagttctccgggcgtg
gaacgggtctgtttccgggctcgaatccagccctggcacggtggcctgctccaaccgcta
ccttgctctttcgagatggggctgccacgccgccggttcagctccgaggccgcagaatct
ggtagcccagagaccaagaaacctacatttatggatgaggaagttcaaagcatactcacg
aaaatgacaggcttgaacttgcagaagacttttaagccagctatacaagaactgaagcca
ccaacctataagctaatgactcaggcacagttggaagaggctacaagacaggcagttgag
gcagctaaagtacgattaaaaatgccaccagttctggaagagcgagtaccaataaatgat
gtgttagctgaagataagattttggaaggaacagaaacaaccaaatatgtgtttactgat
atatcatatagcataccacaccgggagcgttttattgtcgtcagagaaccaagtggcaca
ctacgcaaagcctcttgggaagaacgggaccgaatgatacaagtttatttcccaaaagaa
ggtcgtaaaattttgacaccaataattttcaaggaagaaaatcttaggactatgtatagc
caggacaggcatgttgatgtcctcaatctctgctttgcccagtttgagccagattccaca
gagtatatcaaggttcatcacaagacctatgaagatatagataaacgtggaaaatatgac
cttttacgttcaacaagatactttggtggaatggtgtggtattttgtaaataataaaaag
attgatggtttgctgattgaccagattcagagagatttaatcgatgatgcaaccaacttg
gtccagctgtatcacgtgctccatccagatggccagtcggctcaaggggccaaggatcag
gctgctgagggaataaatttaatcaaggtctttgcaaaaacagaagcacagaagggagcc
tatatagaactaacactgcagacttatcaagaagcactcagtcgccattctgcagcttcc
taa

DBGET integrated database retrieval system