KEGG   Homo sapiens (human): 56997Help
Entry
56997             CDS       T01001                                 

Gene name
COQ8A, ADCK3, ARCA2, CABC1, COQ10D4, COQ8, SCAR9
Definition
(RefSeq) coenzyme Q8A
  KO
K08869  
aarF domain-containing kinase
Organism
hsa  Homo sapiens (human)
Disease
H00999  
Coenzyme Q10 deficiency
H01891  
Autosomal recessive spinocerebellar ataxias
Brite
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  ABC1 family
   56997 (COQ8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NI60(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.13
AA seq 647 aa AA seqDB search
MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQG
QDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPDQSAPPSLGHAHSEGPAPAYV
ASGPFREAGFPGQASSPLGRANGRLFANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEK
ARQAKARPENKQHKQTLSEHARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRSE
DPSGKKAVLGSSPFLSEANAERIVRTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERV
RQSADFMPLKQMMKTLNNDLGPNWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQ
YPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELALECDYQREAACARKFRD
LLKGHPFFYVPEIVDELCSPHVLTTELVSGFPLDQAEGLSQEIRNEICYNILVLCLRELF
EFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQIIRAAADRDRETVRAK
SIEMKFLTGYEVKVMEDAHLDAILILGEAFASDEPFDFGTQSTTEKIHNLIPVMLRHRLV
PPPEETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCKRQAQQ
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatattgggagacaccatcatggtggctaaaggccttgtcaagctgacccag
gcggccgtggaaacccacctgcagcacttgggcatcggaggggagctgatcatggcggcc
agggccctgcagtccacggctgtggagcagattggcatgttcttggggaaggtgcagggt
caggataaacatgaagaatattttgctgagaacttcggcggcccagaaggggagttccac
ttctcagtcccgcatgcagccggagcctccacagacttctcttcagcctccgctcccgac
cagtcagcgcccccatccctgggtcatgcccacagcgagggcccagctcctgcctacgtg
gccagtggaccctttagagaagccgggttccccggccaggcctcctcccctctgggcagg
gccaacgggaggctctttgcaaaccccagagactcattctctgccatgggctttcagcga
aggttcttccaccaggaccaatcccctgttgggggcctcacagccgaggacattgagaag
gcccggcaggctaaggctcgccccgagaacaagcagcacaaacagacgctcagcgagcat
gcccgggagcggaaggtgcctgtgacgaggattggccggctggccaacttcggaggtctg
gccgtgggcctgggcttcggggcactggcagaggtcgccaagaagagcctgcgctccgag
gacccctcagggaagaaggccgtgctgggttccagtcctttcctgtccgaggccaatgca
gagcggatcgtgcgcacgctctgcaaggtgcgtggtgcggcactcaagctgggccagatg
ctgagcatccaggatgatgcctttatcaacccccacctggctaagatcttcgagcgggtg
cggcagagcgcggacttcatgccactgaagcagatgatgaaaactctcaacaacgacctg
ggccccaactggcgggacaagttggaatacttcgaggagcggcccttcgccgccgcatcc
attgggcaggtgcacttggcccgaatgaagggcggccgcgaggtggccatgaagatccag
taccctggcgtggcccagagcatcaacagtgatgtcaacaacctcatggccgtgttgaac
atgagcaacatgcttccagaaggcctgttccccgagcacctgatcgacgtgctgaggcgg
gagctggccctggagtgtgactaccagcgagaggccgcctgtgcccgcaagttcagggac
ctgctgaagggccaccccttcttctatgtgcctgagattgtggatgagctctgcagccca
catgtgctgaccacagagctggtgtctggcttccccctggaccaggccgaagggctcagc
caggagattcggaacgagatctgctacaacatcctggttctgtgcctgagggagctgttc
gagttccacttcatgcaaacagaccccaactggtccaacttcttctatgacccccagcag
cacaaggtggctcttttggattttggggcaacgcgggaatatgacagatccttcaccgac
ctctacattcagatcatcagggctgctgccgacagggacagggagactgtgcgggcgaaa
tccatagagatgaagttcctcaccggctacgaggtcaaggtcatggaagacgcccacttg
gatgccatcctcatcctgggggaggccttcgcctctgatgagccttttgattttggcact
cagagcaccaccgagaagatccacaacctgattcccgtcatgctgaggcaccgtctcgtc
cccccacccgaggaaacctactccctgcacaggaagatggggggctccttcctcatctgc
tccaagctgaaggcccgcttcccctgcaaggccatgttcgaggaggcctacagcaactac
tgcaagaggcaggcccagcagtag

DBGET integrated database retrieval system