KEGG   Homo sapiens (human): 56998Help
Entry
56998             CDS       T01001                                 

Gene name
CTNNBIP1, ICAT
Definition
catenin, beta interacting protein 1
Orthology
K04493  
Beta-catenin-interacting protein 1 (Inhibitor of beta-catenin and Tcf-4)
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    56998 (CTNNBIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 81 aa AA seqDB search
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgagggagctcccgggaagagtccggaggagatgtacattcagcagaaggtc
cgagtgctgctcatgctgcggaagatgggatcaaacctgacagccagcgaggaggagttc
ctgcgcacctatgcaggggtggtcaacagccagctcagccagctgcctccgcactccatc
gaccagggtgcagaggacgtggtgatggcgttttccaggtcggagacggaagaccggagg
cagtag

DBGET integrated database retrieval system