KEGG   Homo sapiens (human): 570Help
Entry
570               CDS       T01001                                 

Gene name
BAAT, BACAT, BAT
Definition
bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) (EC:2.3.1.65 3.1.2.2)
Orthology
K00659  
bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Taurine and hypotaurine metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Peroxisome
Bile secretion
Module
Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Disease
H00407  
Peroxisomal beta-oxidation enzyme deficiency
Class
Metabolism; Lipid metabolism; Primary bile acid biosynthesis [PATH:hsa00120]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:hsa01040]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:hsa00430]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
9q22.3
AA seq 418 aa AA seqDB search
MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDL
NHASSLGGDYMGVHPMGLFWSLKPEKLLTRLLKRDVMNRPFQVQVKLYDLELIVNNKVAS
APKASLTLERWYVAPGVTRIKVREGRLRGALFLPPGEGLFPGVIDLFGGLGGLLEFRASL
LASRGFASLALAYHNYEDLPRKPEVTDLEYFEEAANFLLRHPKVFGSGVGVVSVCQGVQI
GLSMAIYLKQVTATVLINGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFE
TTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLLSYPGA
GHLIEPPYSPLCCASTTHDLRLHWGGEVIPHAAAQEHAWKEIQRFLRKHLIPDVTSQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatccagttgacagctacccctgtgagtgcacttgttgatgagccagtgcatatccga
gctacaggcctgattccctttcagatggtgagttttcaggcatcactggaagatgaaaac
ggagacatgttttattctcaagcccactatagggccaatgaattcggtgaggtggacctg
aatcatgcttcttcacttggaggggattatatgggagtccaccccatgggtctcttctgg
tctctgaaacctgaaaagctattaacaagactgttgaaaagagatgtgatgaataggcct
ttccaggtccaagtaaaactttatgacttagagttaatagtgaacaataaagttgccagt
gctccaaaggccagcctgactttggagaggtggtatgtggcacctggtgtcacacgaatt
aaggttcgagaaggccgccttcgaggagctctctttctccctccaggagagggtctcttc
ccaggggtaattgatttgtttggtggtttgggtgggctgcttgaatttcgggccagcctc
ctagccagtcgtggcttcgcctccttggccttggcttaccataactatgaagacctgccc
cgcaaaccagaagtaacagatttggaatattttgaggaggctgccaactttctcctgaga
catccaaaggtctttggctcaggcgttggggtagtctctgtatgtcaaggagtacagatt
ggactatctatggctatttacctaaagcaagtcacagccacggtacttattaatgggacc
aactttccttttggcattccacaggtatatcatggtcagatccatcagccccttccccat
tctgcacaattaatatccaccaatgccttggggttactagagctctatcgcacttttgag
acaactcaagttggggccagtcaatatttgtttcctattgaagaggcccaggggcaattc
ctcttcattgtaggagaaggtgataagactatcaacagcaaagcacacgctgaacaagcc
ataggacagctgaagagacatgggaagaacaactggaccctgctatcttaccctggggca
ggccacctgatagaacctccctattctcctctgtgctgtgcctcaacgacccacgatttg
aggttacactggggaggagaggtgatcccacacgcagctgcacaggaacatgcttggaag
gagatccagagatttctcaggaagcacctcattccagatgtgaccagtcaactctaa

DBGET integrated database retrieval system