KEGG   Homo sapiens (human): 570Help
Entry
570               CDS       T01001                                 

Gene name
BAAT, BACAT, BAT
Definition
bile acid CoA:amino acid N-acyltransferase (EC:2.3.1.65 3.1.2.2)
Orthology
K00659  
bile acid-CoA:amino acid N-acyltransferase [EC:2.3.1.65 3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Primary bile acid biosynthesis
Taurine and hypotaurine metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Peroxisome
Bile secretion
Module
Conjugated bile acid biosynthesis, cholate => taurocholate/glycocholate
Disease
H00407  
Peroxisomal beta-oxidation enzyme deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00120 Primary bile acid biosynthesis
    570 (BAAT)
   01040 Biosynthesis of unsaturated fatty acids
    570 (BAAT)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    570 (BAAT)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    570 (BAAT)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    570 (BAAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.65  bile acid-CoA:amino acid N-acyltransferase
     570 (BAAT)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     570 (BAAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
9q22.3
AA seq 418 aa AA seqDB search
MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDL
NHASSLGGDYMGVHPMGLFWSLKPEKLLTRLLKRDVMNRPFQVQVKLYDLELIVNNKVAS
APKASLTLERWYVAPGVTRIKVREGRLRGALFLPPGEGLFPGVIDLFGGLGGLLEFRASL
LASRGFASLALAYHNYEDLPRKPEVTDLEYFEEAANFLLRHPKVFGSGVGVVSVCQGVQI
GLSMAIYLKQVTATVLINGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFE
TTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLLSYPGA
GHLIEPPYSPLCCASTTHDLRLHWGGEVIPHAAAQEHAWKEIQRFLRKHLIPDVTSQL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatccagttgacagctacccctgtgagtgcacttgttgatgagccagtgcatatccga
gctacaggcctgattccctttcagatggtgagttttcaggcatcactggaagatgaaaac
ggagacatgttttattctcaagcccactatagggccaatgaattcggtgaggtggacctg
aatcatgcttcttcacttggaggggattatatgggagtccaccccatgggtctcttctgg
tctctgaaacctgaaaagctattaacaagactgttgaaaagagatgtgatgaataggcct
ttccaggtccaagtaaaactttatgacttagagttaatagtgaacaataaagttgccagt
gctccaaaggccagcctgactttggagaggtggtatgtggcacctggtgtcacacgaatt
aaggttcgagaaggccgccttcgaggagctctctttctccctccaggagagggtctcttc
ccaggggtaattgatttgtttggtggtttgggtgggctgcttgaatttcgggccagcctc
ctagccagtcgtggcttcgcctccttggccttggcttaccataactatgaagacctgccc
cgcaaaccagaagtaacagatttggaatattttgaggaggctgccaactttctcctgaga
catccaaaggtctttggctcaggcgttggggtagtctctgtatgtcaaggagtacagatt
ggactatctatggctatttacctaaagcaagtcacagccacggtacttattaatgggacc
aactttccttttggcattccacaggtatatcatggtcagatccatcagccccttccccat
tctgcacaattaatatccaccaatgccttggggttactagagctctatcgcacttttgag
acaactcaagttggggccagtcaatatttgtttcctattgaagaggcccaggggcaattc
ctcttcattgtaggagaaggtgataagactatcaacagcaaagcacacgctgaacaagcc
ataggacagctgaagagacatgggaagaacaactggaccctgctatcttaccctggggca
ggccacctgatagaacctccctattctcctctgtgctgtgcctcaacgacccacgatttg
aggttacactggggaggagaggtgatcccacacgcagctgcacaggaacatgcttggaag
gagatccagagatttctcaggaagcacctcattccagatgtgaccagtcaactctaa

DBGET integrated database retrieval system