KEGG   Homo sapiens (human): 57007Help
Entry
57007             CDS       T01001                                 

Gene name
ACKR3, CMKOR1, CXC-R7, CXCR-7, CXCR7, GPR159, RDC-1, RDC1
Definition
atypical chemokine receptor 3
Orthology
K04304  
C-X-C chemokine receptor type 7
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 362 aa AA seqDB search
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVT
HLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAIS
ASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQS
TK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcatctcttcgactactcagagccagggaacttctcggacatcagctggcca
tgcaacagcagcgactgcatcgtggtggacacggtgatgtgtcccaacatgcccaacaaa
agcgtcctgctctacacgctctccttcatttacattttcatcttcgtcatcggcatgatt
gccaactccgtggtggtctgggtgaatatccaggccaagaccacaggctatgacacgcac
tgctacatcttgaacctggccattgccgacctgtgggttgtcctcaccatcccagtctgg
gtggtcagtctcgtgcagcacaaccagtggcccatgggcgagctcacgtgcaaagtcaca
cacctcatcttctccatcaacctcttcggcagcattttcttcctcacgtgcatgagcgtg
gaccgctacctctccatcacctacttcaccaacacccccagcagcaggaagaagatggta
cgccgtgtcgtctgcatcctggtgtggctgctggccttctgcgtgtctctgcctgacacc
tactacctgaagaccgtcacgtctgcgtccaacaatgagacctactgccggtccttctac
cccgagcacagcatcaaggagtggctgatcggcatggagctggtctccgttgtcttgggc
tttgccgttcccttctccattatcgctgtcttctacttcctgctggccagagccatctcg
gcgtccagtgaccaggagaagcacagcagccggaagatcatcttctcctacgtggtggtc
ttccttgtctgctggctgccctaccacgtggcggtgctgctggacatcttctccatcctg
cactacatccctttcacctgccggctggagcacgccctcttcacggccctgcatgtcaca
cagtgcctgtcgctggtgcactgctgcgtcaaccctgtcctctacagcttcatcaatcgc
aactacaggtacgagctgatgaaggccttcatcttcaagtactcggccaaaacagggctc
accaagctcatcgatgcctccagagtctcagagacggagtactctgccttggagcagagc
accaaatga

DBGET integrated database retrieval system