KEGG   Homo sapiens (human): 57030Help
Entry
57030             CDS       T01001                                 

Gene name
SLC17A7, BNPI, VGLUT1
Definition
solute carrier family 17 (vesicular glutamate transporter), member 7
Orthology
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    57030 (SLC17A7)
   04723 Retrograde endocannabinoid signaling
    57030 (SLC17A7)
   04721 Synaptic vesicle cycle
    57030 (SLC17A7)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    57030 (SLC17A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 560 aa AA seqDB search
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgccaggaggagtttcggaagctagcgggtcgtgctctcgggaagctgcac
cgccttctggagaagcggcaggaaggcgcggagacgctggagctgagtgcggatgggcgc
ccggtgaccacgcagacccgggacccgccggtggtggactgcacctgcttcggcctccct
cgccgctacattatcgccatcatgagtggtctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaataacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagcccagttcagctgggatccagagactgtcggcctcatacac
ggctcctttttctggggctacattgtcactcagattccaggaggatttatctgtcaaaaa
tttgcagccaacagagttttcggctttgctattgtggcaacatccactctaaacatgctg
atcccctcagctgcccgcgtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacataccccgcctgccatgggatctggagcaaatgggccccaccc
ttagaacggagtcgcctggcgacgacagccttttgtggttcctatgctggggcggtggtc
gcgatgcccctcgccggggtccttgtgcagtactcaggatggagctctgttttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcctacgagtccccc
gcgctgcaccccagcatctcggaggaggagcgcaagtacatcgaggacgccatcggagag
agcgcgaaactcatgaaccccctcacgaagtttagcactccctggcggcgcttcttcacg
tctatgccagtctatgccatcatcgtggccaacttctgccgcagctggacgttctacctg
ctgctcatctcccagcccgcctacttcgaagaagtgttcggcttcgagatcagcaaggta
ggcctggtgtccgcgctgccccacctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgcggagccgccgcatcatgtccaccaccaacgtgcgcaagttgatg
aactgcggaggcttcggcatggaagccacgctgctgttggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctagccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatagccccgcgctacgccagcatcctcatgggcatc
tccaacggcgtgggcacactgtcgggcatggtgtgccccatcatcgtgggggccatgact
aagcacaagactcgggaggagtggcagtacgtgttcctaattgcctccctggtgcactat
ggaggtgtcatcttctacggggtctttgcttctggagagaagcagccgtgggcagagcct
gaggagatgagcgaggagaagtgtggcttcgttggccatgaccagctggctggcagtgac
gacagcgaaatggaggatgaggctgagcccccgggggcaccccctgcacccccgccctcc
tatggggccacacacagcacatttcagccccccaggcccccaccccctgtccgggactac
tga

DBGET integrated database retrieval system