KEGG   Homo sapiens (human): 57030Help
Entry
57030             CDS       T01001                                 

Gene name
SLC17A7, BNPI, VGLUT1
Definition
solute carrier family 17 (vesicular glutamate transporter), member 7
Orthology
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Class
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13
AA seq 560 aa AA seqDB search
MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
YGATHSTFQPPRPPPPVRDY
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggagttccgccaggaggagtttcggaagctagcgggtcgtgctctcgggaagctgcac
cgccttctggagaagcggcaggaaggcgcggagacgctggagctgagtgcggatgggcgc
ccggtgaccacgcagacccgggacccgccggtggtggactgcacctgcttcggcctccct
cgccgctacattatcgccatcatgagtggtctgggcttctgcatcagctttggcatccgc
tgcaacctgggcgtggccatcgtctccatggtcaataacagcacgacccaccgcgggggc
cacgtggtggtgcagaaagcccagttcagctgggatccagagactgtcggcctcatacac
ggctcctttttctggggctacattgtcactcagattccaggaggatttatctgtcaaaaa
tttgcagccaacagagttttcggctttgctattgtggcaacatccactctaaacatgctg
atcccctcagctgcccgcgtccactatggctgtgtcatcttcgtgaggatcctgcagggg
ttggtagagggggtcacataccccgcctgccatgggatctggagcaaatgggccccaccc
ttagaacggagtcgcctggcgacgacagccttttgtggttcctatgctggggcggtggtc
gcgatgcccctcgccggggtccttgtgcagtactcaggatggagctctgttttctacgtc
tacggcagcttcgggatcttctggtacctgttctggctgctcgtctcctacgagtccccc
gcgctgcaccccagcatctcggaggaggagcgcaagtacatcgaggacgccatcggagag
agcgcgaaactcatgaaccccctcacgaagtttagcactccctggcggcgcttcttcacg
tctatgccagtctatgccatcatcgtggccaacttctgccgcagctggacgttctacctg
ctgctcatctcccagcccgcctacttcgaagaagtgttcggcttcgagatcagcaaggta
ggcctggtgtccgcgctgccccacctggtcatgaccatcatcgtgcccatcggcggccag
atcgcggacttcctgcggagccgccgcatcatgtccaccaccaacgtgcgcaagttgatg
aactgcggaggcttcggcatggaagccacgctgctgttggtggtcggctactcgcactcc
aagggcgtggccatctccttcctggtcctagccgtgggcttcagcggcttcgccatctct
gggttcaacgtgaaccacctggacatagccccgcgctacgccagcatcctcatgggcatc
tccaacggcgtgggcacactgtcgggcatggtgtgccccatcatcgtgggggccatgact
aagcacaagactcgggaggagtggcagtacgtgttcctaattgcctccctggtgcactat
ggaggtgtcatcttctacggggtctttgcttctggagagaagcagccgtgggcagagcct
gaggagatgagcgaggagaagtgtggcttcgttggccatgaccagctggctggcagtgac
gacagcgaaatggaggatgaggctgagcccccgggggcaccccctgcacccccgccctcc
tatggggccacacacagcacatttcagccccccaggcccccaccccctgtccgggactac
tga

DBGET integrated database retrieval system