KEGG   Homo sapiens (human): 57084Help
Entry
57084             CDS       T01001                                 

Gene name
SLC17A6, DNPI, VGLUT2
Definition
solute carrier family 17 (vesicular glutamate transporter), member 6
Orthology
K12302  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    57084 (SLC17A6)
   04723 Retrograde endocannabinoid signaling
    57084 (SLC17A6)
   04721 Synaptic vesicle cycle
    57084 (SLC17A6)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    57084 (SLC17A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p14.3
AA seq 582 aa AA seqDB search
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMT
IIVPIGGQIADFLRSKQILSTTTVRKIMNCGGFGMEATLLLVVGYSHTRGVAISFLVLAV
GFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKNKSREEWQYVF
LIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGT
TKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtaaaacaaaggattttggccccaggaaaagaggggctaaagaattttgct
ggaaaatcactcggccagatctacagggtgctggagaagaagcaagacaccggggagaca
atcgagctgacggaggatgggaagcccctagaggtgcccgagaggaaggcgccgctgtgc
gactgcacgtgcttcggcctgccccgccgctacattatcgccatcatgagcggcctgggc
ttctgcatctccttcggtatccgctgcaacctgggcgtggccattgtggacatggtcaac
aacagcaccatccaccgcgggggcaaggtcatcaaggagaaagccaaattcaactgggac
ccggaaaccgtggggatgatccacggttccttcttttggggctacatcatcactcagatt
ccgggaggctacatcgcgtctcggctggcagccaacagggttttcggagctgccatactt
cttacctctaccctaaatatgctaattccatcagcagccagagtgcattatggatgtgtc
atctttgtcagaatactgcagggacttgttgagggtgtgacctacccagcatgtcatggg
atatggagcaaatgggccccacctctagagaggagtagactggcaaccacctccttttgt
ggttcctatgccggagctgtgattgcaatgcctttagctggcattcttgtgcagtacact
ggctggtcttcagtgttttatgtctacggaagctttggaatggtctggtacatgttttgg
cttttggtgtcttatgaaagtcctgcaaagcatcctactattacagatgaagaacgtagg
tacatagaagaaagcattggagagagtgcaaatcttttaggtgcaatggaaaaattcaag
actccatggaggaagttttttacatccatgccagtctatgcaataattgttgcaaacttc
tgcagaagctggactttttatttattgcttattagtcagccagcatattttgaggaagtc
tttggatttgaaattagcaaggttggtatgctatctgctgtgccacacttagtaatgaca
attattgtgcctattgggggacaaattgcagattttctaagaagcaagcagattctttca
actacgacagtgagaaagatcatgaattgtggtggttttggcatggaagccacactgctc
ctggtcgttggctattctcatactagaggggtagcaatctcattcttggtacttgcagtg
ggattcagtggatttgctatatctggtttcaatgttaaccacttggatatcgctccaaga
tatgccagtatcttaatgggcatttcgaatggtgttggcacattgtcaggaatggtttgt
cctatcattgttggtgcaatgacaaagaataagtcacgtgaagagtggcagtatgtcttc
ctgatcgctgccctagtccactatggtggagttatattttatgcaatatttgcctcagga
gagaaacaaccctgggcagacccggaggaaacaagtgaagaaaaatgtggatttattcat
gaagatgaactcgatgaagaaacaggggacattactcaaaattatataaattatggtacc
accaagtcttatggtgccacaacacaggccaatggaggttggcctagtggttgggaaaag
aaagaggaatttgtacaaggagaagtacaagactcacatagctataaggaccgagttgat
tattcataa

DBGET integrated database retrieval system