KEGG   Homo sapiens (human): 57105Help
Entry
57105             CDS       T01001                                 

Gene name
CYSLTR2, CYSLT2, CYSLT2R, HG57, HPN321, KPG_011, hGPCR21
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Pranlukast: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    57105 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57105 (CYSLTR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    57105 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q14.2
AA seq 346 aa AA seqDB search
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaatttatgtccttgcaaccatccatctccgtatcagaaatggaaccaaat
ggcaccttcagcaataacaacagcaggaactgcacaattgaaaacttcaagagagaattt
ttcccaattgtatatctgataatatttttctggggagtcttgggaaatgggttgtccata
tatgttttcctgcagccttataagaagtccacatctgtgaacgttttcatgctaaatctg
gccatttcagatctcctgttcataagcacgcttcccttcagggctgactattatcttaga
ggctccaattggatatttggagacctggcctgcaggattatgtcttattccttgtatgtc
aacatgtacagcagtatttatttcctgaccgtgctgagtgttgtgcgtttcctggcaatg
gttcacccctttcggcttctgcatgtcaccagcatcaggagtgcctggatcctctgtggg
atcatatggatccttatcatggcttcctcaataatgctcctggacagtggctctgagcag
aacggcagtgtcacatcatgcttagagctgaatctctataaaattgctaagctgcagacc
atgaactatattgccttggtggtgggctgcctgctgccatttttcacactcagcatctgt
tatctgctgatcattcgggttctgttaaaagtggaggtcccagaatcggggctgcgggtt
tctcacaggaaggcactgaccaccatcatcatcaccttgatcatcttcttcttgtgtttc
ctgccctatcacacactgaggaccgtccacttgacgacatggaaagtgggtttatgcaaa
gacagactgcataaagctttggttatcacactggccttggcagcagccaatgcctgcttc
aatcctctgctctattactttgctggggagaattttaaggacagactaaagtctgcactc
agaaaaggccatccacagaaggcaaagacaaagtgtgttttccctgttagtgtgtggttg
agaaaggaaacaagagtataa

DBGET integrated database retrieval system