KEGG   Homo sapiens (human): 57109Help
Entry
57109             CDS       T01001                                 

Gene name
REXO4, REX4, XPMC2, XPMC2H
Definition
(RefSeq) REX4 homolog, 3'-5' exonuclease
  KO
K18327  
RNA exonuclease 4 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     57109 (REXO4)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   RNase
    57109 (REXO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Pharos: 
Q9GZR2(Tbio)
UniProt: 
Position
9q34.2
AA seq 422 aa AA seqDB search
MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPP
KAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMP
AGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRK
AKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGL
TRALALDCEMVGVGPKGEESMAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPEN
LKQGEELEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKKIRDTQKYKPFKSQVKSG
RPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVMVKKEWESMARDRRPLLTAPDHCSD
DA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggcgaaggtccccgcctccaagcgcgccccgagcagccccgtggctaagccg
ggtcctgtcaagacgctcactcggaagaaaaacaagaagaaaaaaaggttttggaaaagc
aaggcgcgggaagtaagcaagaagccagcaagcggccccggtgctgtggtgcgacctcca
aaggcaccagaagacttttctcaaaactggaaggcgctgcaagagtggctgctgaaacaa
aaatctcaggccccagaaaagcctcttgtcatctctcagatgggttccaaaaagaagccc
aaaattatccagcaaaacaaaaaagagacctcgcctcaagtgaagggagaggagatgccg
gcaggaaaagaccaggaggccagcaggggctctgttccttcaggttccaagatggacagg
agggcgccagtacctcgcaccaaggccagtggaacagagcacaataagaaaggaaccaag
gaaaggacaaatggtgatattgttccagaacgaggggacatcgagcataagaagcggaaa
gctaaggaggcagccccagccccacccaccgaggaagacatctggtttgacgacgtggac
ccagcggatatcgaagctgccataggtccagaggcggccaagatagcgaggaaacagttg
ggtcagagcgagggcagcgtcagcctcagcctcgtgaaagagcaggccttcggcggcctg
acaagagccttagccttggactgtgagatggtgggcgtgggccctaagggggaggagagc
atggccgcccgtgtgtccatcgtgaaccagtatgggaagtgcgtttatgacaagtacgtc
aaaccaaccgagcccgtgacggactataggacagcggtcagtgggattcggcctgagaac
ctcaagcagggagaagagcttgaagttgttcagaaggaagtggcagagatgctgaagggc
agaattctagtggggcacgctctgcataatgacctaaaggtactatttcttgatcatcca
aaaaagaagattcgggacacacagaaatataaacctttcaagagtcaagtaaagagtgga
aggccgtctctgagactactttcagagaagatccttgggctccaggtccagcaggcggag
cactgttcaattcaggatgcccaggcagcaatgaggctgtacgtcatggtgaagaaggag
tgggagagcatggcccgagacaggcgccccctgctgactgctccagaccactgcagtgac
gacgcctag

DBGET integrated database retrieval system