KEGG   Homo sapiens (human): 57132Help
Entry
57132             CDS       T01001                                 

Gene name
CHMP1B, C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2
Definition
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  
charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Necroptosis
Module
ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    57132 (CHMP1B)
  Cell growth and death
   04217 Necroptosis
    57132 (CHMP1B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    57132 (CHMP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57132 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   57132 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   57132 (CHMP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q7LBR1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
18p11.21
AA seq 199 aa AA seqDB search
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacatggagaaacacctgttcaacctgaagttcgcggccaaagaactgagtagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgagtcgatgcagtggctgccagggtccag
acggcggtgacgatgggcaaggtgaccaagtcgatggctggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatttctgctttgatggacaaattcgagcac
cagtttgagactctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctcaccactccccagaaccaagtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgacctcaacatggagctgccgcagggccagaccggctccgtgggcacgagcgtg
gcttcggcggagcaggatgaactgtctcagagactggcccgccttcgggatcaagtgtga

DBGET integrated database retrieval system