KEGG   Homo sapiens (human): 57132Help
Entry
57132             CDS       T01001                                 

Gene name
CHMP1B, C10orf2, C18-ORF2, C18orf2, CHMP1.5, Vps46-2, Vps46B, hVps46-2
Definition
(RefSeq) charged multivesicular body protein 1B
  KO
K12197  charged multivesicular body protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Module
hsa_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    57132 (CHMP1B)
  Cell growth and death
   04217 Necroptosis
    57132 (CHMP1B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    57132 (CHMP1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57132 (CHMP1B)
  Exosomal proteins of other body fluids (saliva and urine)
   57132 (CHMP1B)
  Exosomal proteins of colorectal cancer cells
   57132 (CHMP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Ist1 FlxA Mt_ATP-synt_D Mu-like_Pro DMSP_lyase DUF948
Motif
Other DBs
NCBI-GeneID: 57132
NCBI-ProteinID: NP_065145
OMIM: 606486
HGNC: 24287
Ensembl: ENSG00000255112
Vega: OTTHUMG00000165820
Pharos: Q7LBR1(Tbio)
UniProt: Q7LBR1
Structure
PDB: 

Jmol
Position
18p11.21
AA seq 199 aa AA seqDB search
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKN
QAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEH
QFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSV
ASAEQDELSQRLARLRDQV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacatggagaaacacctgttcaacctgaagttcgcggccaaagaactgagtagg
agtgccaaaaaatgcgataaggaggaaaaggccgaaaaggccaaaattaaaaaggccatt
cagaagggcaacatggaagttgcgaggatacacgccgaaaatgccatccgccagaagaac
caggcggtgaatttcttgagaatgagtgcgcgagtcgatgcagtggctgccagggtccag
acggcggtgacgatgggcaaggtgaccaagtcgatggctggtgtggttaagtcgatggat
gcgacattgaagaccatgaatctggagaagatttctgctttgatggacaaattcgagcac
cagtttgagactctggacgtccagacgcagcaaatggaagacacgatgagcagcacgacg
acgctcaccactccccagaaccaagtggatatgctgctccaggaaatggcagatgaggcg
ggcctcgacctcaacatggagctgccgcagggccagaccggctccgtgggcacgagcgtg
gcttcggcggagcaggatgaactgtctcagagactggcccgccttcgggatcaagtgtga

DBGET integrated database retrieval system