KEGG   Homo sapiens (human): 57151Help
Entry
57151             CDS       T01001                                 

Gene name
LYZL6, LYC1, PRO1485, TKAL754, UNQ754
Definition
lysozyme-like 6 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     57151 (LYZL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 148 aa AA seqDB search
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGRPLFYWLTGCRLR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcgctactcatctatttggtcagcagctttcttgccctaaatcaggccagc
ctcatcagtcgctgtgacttggcccaggtgctgcagctggaggacttggatgggtttgag
ggttactccctgagtgactggctgtgcctggcttttgtggaaagcaagttcaacatatca
aagataaatgaaaatgcagatggaagctttgactatggcctcttccagatcaacagccac
tactggtgcaacgattataagagttactcggaaaacctttgccacgtagactgtcaagat
ctgctgaatcccaaccttcttgcaggcatccactgcgcaaaaaggattgtgtccggagca
cgggggatgaacaactgggtagaatggaggttgcactgttcaggccggccactcttctac
tggctgacaggatgccgcctgagatga

DBGET integrated database retrieval system