KEGG   Homo sapiens (human): 57154Help
Entry
57154             CDS       T01001                                 

Gene name
SMURF1
Definition
SMAD specific E3 ubiquitin protein ligase 1
Orthology
K04678  
E3 ubiquitin ligase SMURF1/2 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    57154 (SMURF1)
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    57154 (SMURF1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    57154 (SMURF1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     57154 (SMURF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    57154 (SMURF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q22.1
AA seq 728 aa AA seqDB search
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPA
PYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVD
HNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLR
HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRIL
QHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQK
ELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTR
VPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVE
ETCGFAVE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaccccgggacacgcaggaacggctccagcatcaagatccgtctgacagtgtta
tgtgccaagaaccttgcaaagaaagacttcttcaggctccctgacccttttgcaaagatt
gtcgtggatgggtctgggcagtgccactcaaccgacactgtgaaaaacacattggaccca
aagtggaaccagcactatgatctatatgttgggaaaacggattcgataaccattagcgtg
tggaaccataagaaaattcacaagaaacagggagctggcttcctgggctgtgtgcggctg
ctctccaatgccatcagcagattaaaagataccggataccagcgtttggatctatgcaaa
ctaaacccctcagatactgatgcagttcgtggccagatagtggtcagtttacagacacga
gacagaataggaaccggcggctcggtggtggactgcagaggactgttagaaaatgaagga
acggtgtatgaagactccgggcctgggaggccgctcagctgcttcatggaggaaccagcc
ccttacacagatagcaccggtgctgctgctggaggagggaattgcaggttcgtggagtcc
ccaagtcaagatcaaagacttcaggcacagcggcttcgaaaccctgatgtgcgaggttca
ctacagacgccccagaaccgaccacacggccaccagtccccggaactgcccgaaggctac
gaacaaagaacaacagtccagggccaagtttactttttgcatacacagactggagttagc
acgtggcacgaccccaggataccaagagaccttaacagtgtgaactgtgatgaacttgga
ccactgccgccaggctgggaagtcagaagtacagtttctgggaggatatattttgtagat
cataataaccgaacaacccagtttacagacccaaggttacaccacatcatgaatcaccag
tgccaactcaaggagcccagccagccgctgccactgcccagtgagggctctctggaggac
gaggagcttcctgcccagagatacgaaagagatctagtccagaagctgaaagtcctcaga
cacgaactgtcgcttcagcagccccaagctggtcattgccgcatcgaagtgtccagagaa
gaaatctttgaggagtcttaccgccagataatgaagatgcgaccgaaagacttgaaaaaa
cggctgatggtgaaattccgtggggaagaaggtttggattacggtggtgtggccagggag
tggctttacttgctgtgccatgaaatgctgaatccttattacgggctcttccagtattct
acggacaatatttacatgttgcaaataaatccggattcttcaatcaaccccgaccacttg
tcttatttccactttgtggggcggatcatggggctggctgtgttccatggacactacatc
aacgggggcttcacagtgcccttctacaagcagctgctggggaagcccatccagctctca
gatctggaatctgtggacccagagctgcataagagcttggtgtggatcctagagaacgac
atcacgcctgtactggaccacaccttctgcgtggaacacaacgccttcgggcggatcctg
cagcatgaactgaaacccaatggcagaaatgtgccagtcacagaggagaataagaaagaa
tacgtccggttgtatgtaaactggaggtttatgagaggaatcgaagcccagttcttagct
ctgcagaaggggttcaatgagctcatccctcaacatctgctgaagccttttgaccagaag
gaactggagctgatcataggcggcctggataaaatagacttgaacgactggaagtcgaac
acgcggctgaagcactgtgtggccgacagcaacatcgtgcggtggttctggcaagcggtg
gagacgttcgatgaagaaaggagggccaggctcctgcagtttgtgactgggtccacgcga
gtcccgctccaaggcttcaaggctttgcaaggcgcggcagggccccggctgttcaccatc
cacctgatagacgcgaacacagacaaccttccgaaggcccatacctgctttaaccggatc
gacattccaccatatgagtcctatgagaagctctacgagaagctgctgacagccgtggag
gagacctgcgggtttgctgtggagtga

DBGET integrated database retrieval system