KEGG   Homo sapiens (human): 57158Help
Entry
57158             CDS       T01001                                 

Gene name
JPH2, CMH17, JP-2, JP2
Definition
junctophilin 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.12
AA seq 696 aa AA seqDB search
MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTF
EGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGT
ETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSP
ASPASDGPALPSPAIPRGGFALSLLANAEAAARAPKGGGLFQRGALLGKLRRAESRTSVG
SQRSRVSFLKSDLSSGASDAASTASLGEAAEGADEAAPFEADIDATTTETYMGEWKNDKR
SGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDTKRRMLQLKSN
KVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQESNIARTLAR
ELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGAGAAGLPQPPRESPQLHERETPRP
EGGSPSPAGTPPQPKRPRPGVSKDGLLSPGAWNGEPSGEGSRSVTPSEGAGRRSPARPAT
ERMAIEALQAPPAPSREPEVALYQGYHSYAVRTTPPEPPPFEDQPEPEVSGSESAPSSPA
TAPLQAPTLRGPEPARETPAKLEPKPIIPKAEPRAKARKTEARGLTKAGAKKKARKEAAL
AAEAEVEVEEVPNTILICMVILLNIGLAILFVHLLT
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggggccgcttcgactttgatgatggaggggcgtactgcgggggctgggagggg
ggaaaggcccatgggcatggactgtgcacaggccccaagggccagggcgaatactctggc
tcctggaactttggctttgaggtggcaggtgtctacacctggcccagcggaaacaccttt
gagggatactggagccagggcaaacggcatgggctgggcatagagaccaaggggcgctgg
ctctacaagggcgagtggacacatggcttcaagggacgctacggaatccggcagagctca
agcagcggtgccaagtatgagggcacctggaacaatggcctgcaagacggctatggcacc
gagacctatgctgatggagggacgtaccaaggccagttcaccaacggcatgcgccatggc
tacggagtacgccagagcgtgccctacgggatggccgtggtggtgcgctcgccgctgcgc
acgtcgctgtcgtccctgcgcagcgagcacagcaacggcacggtggccccggactctccc
gcctcgccggcctccgacggccccgcgctgccctcgcccgccatcccgcgtggcggcttc
gcgctcagcctcctggccaatgccgaggcggccgcgcgggcgcccaagggcggcggcctc
ttccagcggggcgcgctgctgggcaagctgcggcgcgcagagtcgcgcacgtccgtgggt
agccagcgcagccgtgtcagcttccttaagagcgacctcagctcgggcgccagcgacgcc
gcgtccaccgccagcctgggagaggccgccgagggcgccgacgaggccgcacccttcgag
gccgatatcgacgccaccaccaccgagacctacatgggcgagtggaagaacgacaaacgc
tcgggcttcggcgtgagcgaacgctccagtggcctccgctacgagggcgagtggctggac
aacctgcgccacggctatggctgcaccacgctgcccgacggccaccgcgaggagggcaag
taccgccacaacgtgctggtcaaggacaccaagcgccgcatgctgcagctcaagagcaac
aaggtccgccagaaagtggagcacagtgtggagggtgcccagcgcgccgctgctatcgcg
cgccagaaggccgagattgccgcctccaggacaagccacgccaaggccaaagctgaggca
gcggaacaggccgccctggctgccaaccaggagtccaacattgctcgcactttggccagg
gagctggctccggacttctaccagccaggtccggaatatcagaagcgccggctgctgcag
gagatcctggagaactcggagagcctgctggagccccccgaccggggcgccggcgcagcg
ggcctcccacagccgccccgcgagagcccgcagctgcacgagcgtgagacccctcggccc
gagggtggctccccgtcaccggccgggacgcccccgcagcccaagcggcccaggcccggg
gtgtccaaggacggcctgctgagcccaggcgcctggaacggcgagcccagcggtgagggc
agccggtcagtcactccgtccgagggcgcgggccgccgcagccccgcgcgtccagccacc
gagcgcatggccatcgaggctctgcaggcaccgcctgcgccgtcgcgggagccggaggtg
gcgctttaccagggctaccacagctatgctgtgcgcaccacgccgcccgagcccccaccc
tttgaggaccagcccgagcccgaggtctccgggtccgagtccgcgccctcgtccccggcc
accgccccgctgcaggcccccacgctccgaggccccgagcctgcacgcgagacccccgcc
aagctggagcccaagcccatcatccccaaagccgagcccagggccaaggcccgcaagact
gaggctcgagggctgaccaaggcgggggccaagaagaaggcgcggaaggaggccgcactg
gcggcagaggcggaggtggaggtggaagaggtccccaacaccatcctcatctgcatggtg
atcctgctgaacatcggcctggccatcctctttgttcacctcctgacctga

DBGET integrated database retrieval system