KEGG   Homo sapiens (human): 57180Help
Entry
57180             CDS       T01001                                 

Gene name
ACTR3B, ARP11, ARP3BETA
Definition
(RefSeq) ARP3 actin-related protein 3 homolog B (yeast)
  KO
K18584  
actin-related protein 3
Organism
hsa  Homo sapiens (human)
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     57180 (ACTR3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   57180 (ACTR3B)
  Exosomal proteins of other body fluids (saliva and urine)
   57180 (ACTR3B)
  Exosomal proteins of bladder cancer cells
   57180 (ACTR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q36.1
AA seq 418 aa AA seqDB search
MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDF
FIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTP
ENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVK
EFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVV
DEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKP
KPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctccctgcctccctgcgtggtggactgtggcaccgggtataccaagcttggc
tacgcaggcaacactgagccccagttcattattccttcatgtattgccatcagagagtca
gcaaaggtagttgaccaagctcaaaggagagtgttgaggggagttgatgaccttgacttt
ttcataggagatgaagccatcgataaacctacatatgctacaaagtggccgatacgacat
ggaatcattgaagactgggatcttatggaaaggttcatggagcaagtggtttttaaatat
cttcgagctgaacctgaggaccattattttttaatgacagaacctccactcaatacacca
gaaaacagagagtatcttgcagaaattatgtttgaatcatttaacgtaccaggactctac
attgcagttcaggcagtgctggccttggcggcatcttggacatctcgacaagtgggtgaa
cgtacgttaacggggatagtcattgacagcggagatggagtcacccatgttatcccagtg
gcagaaggttatgtaattggaagctgcatcaaacacatcccgattgcaggtagagatatt
acgtatttcattcaacagctgctaagggagagggaggtgggaatccctcctgagcagtca
ctggagaccgcaaaagccattaaggagaaatactgttacatttgccccgatatagtcaag
gaatttgccaagtatgatgtggatccccggaagtggatcaaacagtacacgggtatcaat
gcgatcaaccagaagaagtttgttatagacgttggttacgaaagattcctgggacctgaa
atattctttcacccggagtttgccaacccagactttatggagtccatctcagatgttgtt
gatgaagtaatacagaactgccccatcgatgtgcggcgcccgctgtataagaatgtcgta
ctctcaggaggctccaccatgttcagggatttcggacgccgactgcagagggatttgaag
agagtggtggatgctaggctgaggctcagcgaggagctcagcggcgggaggatcaagccg
aagcctgtggaggtccaggtggtcacgcatcacatgcagcgctacgccgtgtggttcgga
ggctccatgctggcctcgactcccgagttctttcaggtctgccacaccaagaaggactat
gaagagtacgggcccagcatctgccgccacaaccccgtctttggagtcatgtcctag

DBGET integrated database retrieval system