KEGG   Homo sapiens (human): 57211Help
Entry
57211             CDS       T01001                                 

Gene name
ADGRG6, APG1, DREG, GPR126, LCCS9, PR126, PS1TP2, VIGR
Definition
(RefSeq) adhesion G protein-coupled receptor G6
  KO
K08463  G protein-coupled receptor 126
Organism
hsa  Homo sapiens (human)
Disease
H00865  Lethal congenital contractural syndrome (LCCS)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Putative / unclassified Class B GPCRs
    57211 (ADGRG6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 CUB GPS Pentaxin CUB_2
Motif
Other DBs
NCBI-GeneID: 57211
NCBI-ProteinID: NP_065188
OMIM: 612243
HGNC: 13841
Ensembl: ENSG00000112414
Vega: OTTHUMG00000015709
Pharos: Q86SQ4(Tbio)
UniProt: Q86SQ4
Position
6q24.2
AA seq 1221 aa AA seqDB search
MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPND
YPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSF
NSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPEL
SAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVK
EKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEI
VSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYL
IPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWA
LLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQ
PSEYVLPCPDKPGFSASRICFYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQN
LTSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTIDEL
AFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGLPSNNESYFQMDFESGQVDPL
ASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNITIQ
NLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKI
LMNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALV
KVFNTYIRRYILKFCIIGWGLPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVI
FYVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMT
WGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNVSYEHSF
NKSGSLRQCFHGQVLVKTGPC
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttcgctcagatcgaatgtggagctgccattggaaatggaagcccagtcctctc
ctgttcttatttgctttatatatcatgtgtgttcctcactcagtgtggggatgtgccaac
tgccgagtggttttgtccaacccttctgggacctttacttctccatgctaccctaacgac
tacccaaacagccaggcttgcatgtggacgctccgagcccccaccggttatatcattcag
ataacatttaacgactttgacattgaagaagctcccaattgcatttatgactcattatcc
cttgataatggagagagccagactaaattttgtggagcaactgccaaaggcctatcattt
aactcaagtgcgaatgagatgcatgtgtccttttcaagtgactttagcatccagaagaaa
ggtttcaatgccagctacatcagagttgccgtgtccttaaggaatcaaaaggtcatttta
ccccagacatcagatgcttaccaggtatctgttgcaaaaagcatctctattccagagctc
agtgctttcacactctgctttgaagcaaccaaagttggccatgaagacagtgattggaca
gctttctcctactcaaatgcatccttcacacaattgctcagttttggaaaggccaagagt
ggctactttctatccatttctgattcaaaatgtttgttgaataatgcattacctgtcaaa
gaaaaagaagacatttttgcagaaagctttgaacagctctgccttgtttggaataattct
ttgggctctattggtgtaaatttcaaaagaaactatgaaacagttccatgtgattctacc
attagtaaagttattcctgggaatgggaaattgttgttgggctccaatcaaaatgaaatt
gtctctctaaaaggggacatttataactttcgactttggaattttaccatgaatgccaaa
atcctctccaacctcagctgtaatgtgaaagggaatgtagtcgactggcaaaatgacttc
tggaatatcccaaacctagctctgaaagctgaaagcaacctaagctgtggttcctacctg
atcccgctcccagcagcagaactggccagctgtgcagacctggggaccctctgtcaagct
actgtaaactctcctagtactacaccacccactgtcaccactaacatgcctgttactaac
agaatcgataaacaaaggaatgatggaattatctatagaatatccgtagtgattcagaac
atccttcgtcaccctgaggtaaaagtacagagcaaggtggcagaatggctcaattcaacc
ttccaaaattggaactacacggtttatgtcgttaatatcagttttcacctgagtgctgga
gaggacaagattaaagtcaagagaagccttgaggatgagccaaggttggtgctttgggcc
cttctagtttacaatgctaccaacaatactaatttagaaggaaaaatcattcagcagaag
ctcctaaaaaataatgagtccttggatgaaggcttgaggctacatacagtgaatgtgaga
caactgggtcattgtcttgccatggaggaacccaaaggctactactggccatctatccaa
ccttctgaatacgttcttccttgtccagacaagcctggcttttctgcttctcggatatgt
ttttacaatgctaccaacccattggtaacctactggggacctgttgatatctccaactgt
ttaaaagaagcaaatgaagttgctaaccagattttaaatttaactgctgatgggcagaac
ttaacctcagccaatattaccaacattgtggaacaggtcaaaagaattgtgaataaagaa
gaaaacattgatataacacttggctcaactctaatgaatatattttctaatatcttaagc
agttcagacagtgacttgcttgagtcatcttctgaagctttaaaaacaattgatgaattg
gccttcaagatagacctaaatagcacatcacatgtgaatattacaactcggaacttggct
ctcagcgtatcatccctgttaccagggacaaatgcaatttcaaattttagcattggtctt
ccaagcaataatgaatcgtatttccagatggattttgagagtggacaagtggatccactg
gcatctgtaattttgcctccaaacttacttgagaatttaagtccagaagattctgtatta
gttagaagagcacagtttactttcttcaacaaaactggacttttccaggatgtaggaccc
caaagaaaaactttagtgagttatgtgatggcgtgcagtattggaaacattactatccag
aatctgaaggatcctgttcaaataaaaatcaaacatacaagaactcaggaagtgcatcat
cccatctgtgccttctgggatctgaacaaaaacaaaagttttggaggatggaacacgtca
ggatgtgttgcacacagagattcagatgcaagtgagacagtctgcctgtgtaaccacttc
acacactttggagttctgatggaccttccaagaagtgcctcacagttagatgcaagaaac
actaaagtcctcactttcatcagctatattgggtgtggaatatctgctattttttcagca
gcaactctcctgacatatgttgcttttgagaaattgcgaagggattatccctccaaaatc
ttgatgaacctgagcacagccctgctgttcctgaatctcctcttcctcctagatggctgg
atcacctccttcaatgtggatggactttgcattgctgttgcagtcctgttgcatttcttc
cttctggcaacctttacctggatggggctagaagcaattcacatgtacattgctctagtt
aaagtatttaacacttacattcgccgatacattctaaaattctgcatcattggctggggt
ttgcctgccttagtggtgtcagttgttctagcgagcagaaacaacaatgaagtctatgga
aaagaaagttatgggaaagaaaaaggtgatgaattctgttggattcaagatccagtcata
ttttatgtgacctgtgctgggtattttggagtcatgttttttctgaacattgccatgttc
attgtggtaatggtgcagatctgtgggaggaatggcaagagaagcaaccggaccctgaga
gaagaagtgttaaggaacctgcgcagtgtggttagcttgacctttctgttgggcatgaca
tggggttttgcattctttgcctggggacccttaaatatccccttcatgtacctcttctcc
atcttcaattcattacaaggcttatttatattcatcttccactgtgctatgaaggagaat
gttcagaaacagtggcggcggcatctctgctgtggtagatttcggttagcagataactca
gattggagtaagacagctaccaatatcatcaagaaaagttctgataatctaggaaaatct
ttgtcttcaagctccattggttccaactcaacctatcttacatccaaatctaaatccagc
tctaccacctatttcaaaaggaatagccacacagataatgtctcctatgagcattccttc
aacaaaagtggatcactcagacagtgcttccatggacaagtccttgtcaaaactggccca
tgctga

DBGET integrated database retrieval system