KEGG   Homo sapiens (human): 57216Help
Entry
57216             CDS       T01001                                 

Gene name
VANGL2, LPP1, LTAP, STB1, STBM, STBM1
Definition
VANGL planar cell polarity protein 2
Orthology
K04510  
vang-like
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    57216 (VANGL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22-q23
AA seq 521 aa AA seqDB search
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR
GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF
LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV
LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR
QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK
KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV
VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI
LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL
KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgagtcccagtactcgggctattcctacaagtcgggccactcccgcagctcc
cgcaagcacagggaccgccgggaccgacaccgctctaagagtcgagatgggggccgaggg
gacaagtcggtgacaatccaggctcccggggagcccctgctggacaatgagtccacacga
ggggatgagcgggatgacaactggggggaaacgacgacagtagtaacgggcacctcagag
cacagcatctcccatgatgacctcacacgcatcgccaaggacatggaggacagtgtccct
ctggactgctcccgtcacctgggtgtggcagcgggggccaccctggcactgctgtctttc
ctcacgcctctggccttcctgctgctgcccccactgctgtggcgggaggagctggagcct
tgcgggacggcctgcgagggcctcttcatctctgtcgccttcaagctgctcatcctgcta
ctgggcagctgggctctgttcttccgccggcccaaggcctcgctgccccgcgtctttgtg
ctgcgtgccctgcttatggtgctggttttcctgctcgtggtctcctactggctcttctat
ggtgtgcgcatcctggatgctcgggagcgcagctaccagggcgtggtgcagttcgccgtg
tcgctggtggacgcccttcttttcgtgcactacctggccgtggtcctgctggagctgcgc
cagctccagcctcagttcacgctcaaggtcgtgcgctccaccgacggcgccagccgcttc
tacaacgttggccatctcagcatccagcgcgtggcagtgtggatcctggagaagtattac
catgacttccctgtctacaaccctgccctcctcaacctgcccaagtccgtcctggccaag
aaagtgtctggcttcaaggtgtattccctcggagaggaaaacagcaccaacaactccact
ggccagtctcgggctgtgattgcagcggcagctcggaggcgggacaacagtcacaatgag
tactactatgaggaggctgagcatgagcgaagggtgcgcaagaggagggccaggcttgta
gtggcggtggaggaggccttcactcacattaagcggctgcaggaagaggagcagaaaaac
cccagggaggtgatggacccccgggaggcagcccaagccatctttgcatccatggcccgt
gccatgcagaagtaccttcggaccaccaagcagcagccctaccacaccatggagagcatc
ctgcagcaccttgaattctgcatcacgcatgacatgacgcccaaggccttcttggagcga
tacttggcggctggacctaccatccagtaccacaaggaacgctggctggccaaacagtgg
acattggtgagcgaggagccggtgaccaacggcctcaaggatggcatcgttttcctctta
aaacgccaggacttcagcctggtggtcagcaccaagaaggtcccattcttcaaactctcc
gaggaatttgtggatcccaagtcacacaagtttgtcatgaggctgcagtctgagacctca
gtgtga

DBGET integrated database retrieval system