KEGG   Homo sapiens (human): 5724Help
Entry
5724              CDS       T01001                                 

Gene name
PTAFR, PAFR
Definition
(RefSeq) platelet activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05150  Staphylococcus aureus infection
Drug target
Apafant: D01652
Israpafant: D02590
Lexipafant: D04724
Rupatadine (DG01118): D07407 D08497
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5724 (PTAFR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5724 (PTAFR)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    5724 (PTAFR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Platelet activating factor
    5724 (PTAFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 SHNi-TPR DUF1449
Motif
Other DBs
NCBI-GeneID: 5724
NCBI-ProteinID: NP_000943
OMIM: 173393
HGNC: 9582
Ensembl: ENSG00000169403
Vega: OTTHUMG00000003953
Pharos: P25105(Tchem)
UniProt: P25105
Position
1p35.3
AA seq 342 aa AA seqDB search
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagccacatgactcctcccacatggactctgagttccgatacactctcttcccgatt
gtttacagcatcatctttgtgctcggggtcattgctaatggctacgtgctgtgggtcttt
gcccgcctgtacccttgcaagaaattcaatgagataaagatcttcatggtgaacctcacc
atggcggacatgctcttcttgatcaccctgccactttggattgtctactaccaaaaccag
ggcaactggatactccccaaattcctgtgcaacgtggctggctgccttttcttcatcaac
acctactgctctgtggccttcctgggcgtcatcacttataaccgcttccaggcagtaact
cggcccatcaagactgctcaggccaacacccgcaagcgtggcatctctttgtccttggtc
atctgggtggccattgtgggagctgcatcctacttcctcatcctggactccaccaacaca
gtgcccgacagtgctggctcaggcaacgtcactcgctgctttgagcattacgagaagggc
agcgtgccagtcctcatcatccacatcttcatcgtgttcagcttcttcctggtcttcctc
atcatcctcttctgcaacctggtcatcatccgtaccttgctcatgcagccggtgcagcag
cagcgcaacgctgaagtcaagcgccgggcgctgtggatggtgtgcacggtcttggcggtg
ttcatcatctgcttcgtgccccaccacgtggtgcagctgccctggacccttgctgagctg
ggcttccaggacagcaaattccaccaggccattaatgatgcacatcaggtcaccctctgc
ctccttagcaccaactgtgtcttagaccctgttatctactgtttcctcaccaagaagttc
cgcaagcacctcaccgaaaagttctacagcatgcgcagtagccggaaatgctcccgggcc
accacggatacggtcactgaagtggttgtgccattcaaccagatccctggcaattccctc
aaaaattag

DBGET integrated database retrieval system