KEGG   Homo sapiens (human): 5724Help
Entry
5724              CDS       T01001                                 

Gene name
PTAFR, PAFR
Definition
platelet-activating factor receptor
Orthology
K04279  
platelet-activating factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Staphylococcus aureus infection
Drug target
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p35-p34.3
AA seq 342 aa AA seqDB search
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagccacatgactcctcccacatggactctgagttccgatacactctcttcccgatt
gtttacagcatcatctttgtgctcggggtcattgctaatggctacgtgctgtgggtcttt
gcccgcctgtacccttgcaagaaattcaatgagataaagatcttcatggtgaacctcacc
atggcggacatgctcttcttgatcaccctgccactttggattgtctactaccaaaaccag
ggcaactggatactccccaaattcctgtgcaacgtggctggctgccttttcttcatcaac
acctactgctctgtggccttcctgggcgtcatcacttataaccgcttccaggcagtaact
cggcccatcaagactgctcaggccaacacccgcaagcgtggcatctctttgtccttggtc
atctgggtggccattgtgggagctgcatcctacttcctcatcctggactccaccaacaca
gtgcccgacagtgctggctcaggcaacgtcactcgctgctttgagcattacgagaagggc
agcgtgccagtcctcatcatccacatcttcatcgtgttcagcttcttcctggtcttcctc
atcatcctcttctgcaacctggtcatcatccgtaccttgctcatgcagccggtgcagcag
cagcgcaacgctgaagtcaagcgccgggcgctgtggatggtgtgcacggtcttggcggtg
ttcatcatctgcttcgtgccccaccacgtggtgcagctgccctggacccttgctgagctg
ggcttccaggacagcaaattccaccaggccattaatgatgcacatcaggtcaccctctgc
ctccttagcaccaactgtgtcttagaccctgttatctactgtttcctcaccaagaagttc
cgcaagcacctcaccgaaaagttctacagcatgcgcagtagccggaaatgctcccgggcc
accacggatacggtcactgaagtggttgtgccattcaaccagatccctggcaattccctc
aaaaattag

DBGET integrated database retrieval system