KEGG   Homo sapiens (human): 5725Help
Entry
5725              CDS       T01001                                 

Gene name
PTBP1, HNRNP-I, HNRNPI, HNRPI, PTB, PTB-1, PTB-T, PTB2, PTB3, PTB4, pPTB
Definition
(RefSeq) polypyrimidine tract binding protein 1
  KO
K13218  
polypyrimidine tract-binding protein 1
Organism
hsa  Homo sapiens (human)
Brite
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     5725 (PTBP1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    5725 (PTBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 531 aa AA seqDB search
MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRV
IHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPV
LRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQ
SPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLS
LDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLS
VPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGV
YGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREG
QEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGV
VKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggacggcattgtcccagatatagccgttggtacaaagcggggatctgacgagcttttc
tctacttgtgtcactaacggaccgtttatcatgagcagcaactcggcttctgcagcaaac
ggaaatgacagcaagaagttcaaaggtgacagccgaagtgcaggcgtcccctctagagtg
atccacatccggaagctccccatcgacgtcacggagggggaagtcatctccctggggctg
ccctttgggaaggtcaccaacctcctgatgctgaaggggaaaaaccaggccttcatcgag
atgaacacggaggaggctgccaacaccatggtgaactactacacctcggtgacccctgtg
ctgcgcggccagcccatctacatccagttctccaaccacaaggagctgaagaccgacagc
tctcccaaccaggcgcgggcccaggcggccctgcaggcggtgaactcggtccagtcgggg
aacctggccttggctgcctcggcggcggccgtggacgcagggatggcgatggccgggcag
agccccgtgctcaggatcatcgtggagaacctcttctaccctgtgaccctggatgtgctg
caccagattttctccaagttcggcacagtgttgaagatcatcaccttcaccaagaacaac
cagttccaggccctgctgcagtatgcggaccccgtgagcgcccagcacgccaagctgtcg
ctggacgggcagaacatctacaacgcctgctgcacgctgcgcatcgacttttccaagctc
accagcctcaacgtcaagtacaacaatgacaagagccgtgactacacacgcccagacctg
ccttccggggacagccagccctcgctggaccagaccatggccgcggccttcggcctttcc
gttccgaacgtccacggcgccctggcccccctggccatcccctcggcggcggcggcagct
gcggcggcaggtcggatcgccatcccgggcctggcgggggcaggaaattctgtattgctg
gtcagcaacctcaacccagagagagtcacaccccaaagcctctttattcttttcggcgtc
tacggtgacgtgcagcgcgtgaagatcctgttcaataagaaggagaacgccctagtgcag
atggcggacggcaaccaggcccagctggccatgagccacctgaacgggcacaagctgcac
gggaagcccatccgcatcacgctctcgaagcaccagaacgtgcagctgccccgcgagggc
caggaggaccagggcctgaccaaggactacggcaactcacccctgcaccgcttcaagaag
ccgggctccaagaacttccagaacatattcccgccctcggccacgctgcacctctccaac
atcccgccctcagtctccgaggaggatctcaaggtcctgttttccagcaatgggggcgtc
gtcaaaggattcaagttcttccagaaggaccgcaagatggcactgatccagatgggctcc
gtggaggaggcggtccaggccctcattgacctgcacaaccacgacctcggggagaaccac
cacctgcgggtctccttctccaagtccaccatctag

DBGET integrated database retrieval system