KEGG   Homo sapiens (human): 5726Help
Entry
5726              CDS       T01001                                 

Gene name
TAS2R38, PTC, T2R38, T2R61
Definition
taste receptor, type 2, member 38
Orthology
K08474  
taste receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    5726 (TAS2R38)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Taste type 2
    5726 (TAS2R38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q34
AA seq 333 aa AA seqDB search
MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCL
SISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK
LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNT
RLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE
AHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISG
NAKLRRAVMTILLWAQSSLKVRADHKADSRTLC
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttgactctaactcgcatccgcactgtgtcctatgaagtcaggagtacatttctgttc
atttcagtcctggagtttgcagtggggtttctgaccaatgccttcgttttcttggtgaat
ttttgggatgtagtgaagaggcaggcactgagcaacagtgattgtgtgctgctgtgtctc
agcatcagccggcttttcctgcatggactgctgttcctgagtgctatccagcttacccac
ttccagaagttgagtgaaccactgaaccacagctaccaagccatcatcatgctatggatg
attgcaaaccaagccaacctctggcttgctgcctgcctcagcctgctttactgctccaag
ctcatccgtttctctcacaccttcctgatctgcttggcaagctgggtctccaggaagatc
tcccagatgctcctgggtattattctttgctcctgcatctgcactgtcctctgtgtttgg
tgcttttttagcagacctcacttcacagtcacaactgtgctattcatgaataacaataca
aggctcaactggcagattaaagatctcaatttattttattcctttctcttctgctatctg
tggtctgtgcctcctttcctattgtttctggtttcttctgggatgctgactgtctccctg
ggaaggcacatgaggacaatgaaggtctataccagaaactctcgtgaccccagcctggag
gcccacattaaagccctcaagtctcttgtctcctttttctgcttctttgtgatatcatcc
tgtgttgccttcatctctgtgcccctactgattctgtggcgcgacaaaataggggtgatg
gtttgtgttgggataatggcagcttgtccctctgggcatgcagccatcctgatctcaggc
aatgccaagttgaggagagctgtgatgaccattctgctctgggctcagagcagcctgaag
gtaagagccgaccacaaggcagattcccggacactgtgctga

DBGET integrated database retrieval system