KEGG   Homo sapiens (human): 5729Help
Entry
5729              CDS       T01001                                 

Gene name
PTGDR, AS1, ASRT1, DP, DP1, PTGDR1
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  
prostaglandin D2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Fevipiprant: 
Laropiprant: 
Ramatroban: 
Setipiprant: 
Vidupiprant: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5729 (PTGDR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5729 (PTGDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q22.1
AA seq 359 aa AA seqDB search
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgccgttctaccgctgccagaacaccacctctgtggaaaaaggcaactcggcg
gtgatgggcggggtgctcttcagcaccggcctcctgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctcgcggcgtccactgcgcccgctgccctcggtc
ttctacatgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
ccggtggtgctggctgcctacgctcagaaccggagtctgcgggtgcttgcgcccgcattg
gacaactcgttgtgccaagccttcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccctttcttctac
cgacggcacatcaccctgcgcctgggcgcactggtggccccggtggtgagcgccttctcc
ctggctttctgcgcgctacctttcatgggcttcgggaagttcgtgcagtactgccccggc
acctggtgctttatccagatggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtcctcgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctatgcgatgcaccggcggctgcagcggcacccgcgctcctgcacc
agggactgtgccgagccgcgcgcggacgggagggaagcgtcccctcagcccctggaggag
ctggatcacctcctgctgctggcgctgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatgtcaaggagaaaaacaggacctct
gaagaagcagaagacctccgagccttgcgatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagatctccagtatttcggatattttttcacaagattttcatt
agacctcttaggtacaggagccggtgcagcaattccactaacatggaatccagtctgtga

DBGET integrated database retrieval system