KEGG   Homo sapiens (human): 57292Help
Entry
57292             CDS       T01001                                 

Gene name
KIR2DL5A, CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3
Definition
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
  KO
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    57292 (KIR2DL5A)
   04612 Antigen processing and presentation
    57292 (KIR2DL5A)
 Human Diseases
  Immune diseases
   05332 Graft-versus-host disease
    57292 (KIR2DL5A)
Cellular antigens [BR:hsa04090]
 Proteins
  57292 (KIR2DL5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 375 aa AA seqDB search
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
acacatgagggtggtcaggacaagcccttgctgtctgcctggcccagcgctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatggggtgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatgggccctgtgacccctgcacacgcagggacctacagatgtcggggttcacaccca
cgctcccccattgagtggtcagcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcactctcagcccagccgggccccacggttcgcacaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gcccatgaacctaggctccctgcagtgcccagcgtcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctctccatgactca
ccctatgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctcttcatcatcctcttcttctttctcctt
cattgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggac
agaacagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacag
ttggatcactgcgttttcacacagacaaaaatcacttccccttctcagaggcccaagaca
cctccaacagataccaccatgtacatggaacttccaaatgctaagccaagatcattgtct
cctgcccataagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctcaaaaccgggttgctagctcccatgtaccagcagctggaatctga

DBGET integrated database retrieval system