KEGG   Homo sapiens (human): 57292Help
Entry
57292             CDS       T01001                                 

Gene name
KIR2DL5A, CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3, KIR2DL5B
Definition
killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A
Orthology
K07981  
killer cell immunoglobulin-like receptor 2DL
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Graft-versus-host disease
Drug target
Other: 
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:hsa05332]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19p13.3
AA seq 375 aa AA seqDB search
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
acacatgagggtggtcaggacaagcccttgctgtctgcctggcccagcgctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatggggtgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatgggccctgtgacccctgcacacgcagggacctacagatgtcggggttcacaccca
cgctcccccattgagtggtcagcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcactctcagcccagccgggccccacggttcgcacaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gcccatgaacctaggctccctgcagtgcccagcgtcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctctccatgactca
ccctatgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctcttcatcatcctcttcttctttctcctt
cattgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggac
agaacagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacag
ttggatcactgcgttttcacacagacaaaaatcacttccccttctcagaggcccaagaca
cctccaacagataccaccatgtacatggaacttccaaatgctaagccaagatcattgtct
cctgcccataagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctcaaaaccgggttgctagctcccatgtaccagcagctggaatctga

DBGET integrated database retrieval system