KEGG   Homo sapiens (human): 5731Help
Entry
5731              CDS       T01001                                 

Gene name
PTGER1, EP1
Definition
prostaglandin E receptor 1 (subtype EP1), 42kDa
Orthology
K04258  
prostaglandin E receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Alprostadil: 
Gemeprost: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 402 aa AA seqDB search
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttgcgggcccctcaacctgagcctggcgggcgaggcgaccacatgcgcggcg
ccctgggtccccaacacgtcggccgtgccgccgtcgggcgcttcgcccgcgctgcccatc
ttctccatgacgctgggcgccgtgtccaacctgctggcgctggcgctgctggcgcaggcc
gcgggccgcctgcgacgccgccgctcggccgccaccttcctgctgttcgtggccagcctg
ctggccaccgacctggcgggccacgtgatcccgggcgcgctggtgctgcgtctgtacact
gcggggcgcgctccggccggcggggcctgccacttcctgggcggctgcatggtcttcttc
ggcctgtgcccgctgctgctgggctgtggcatggccgtggagcgctgcgtgggcgtcacg
cggccgctgctccacgccgcgcgggtctcggtcgcccgcgcgcgcctggcgctggccgcg
gtggccgcggtggccttggccgtggcgctgctgccgctggcgcgcgtgggccgctatgag
ctgcagtacccgggcacgtggtgcttcatcggcctgggtcccccgggcggctggcgccag
gcactgcttgctggcctcttcgccagcctcggcctggtcgcgctcctcgccgcgctggtg
tgcaacacgctcagcggcctggccctgctacgcgcccgctggcgacgccgctcccgacgg
cctcccccggcctcaggccccgacagccggcgtcgctggggggcgcacggaccccgctcg
gcctccgcctcgtccgcctcgtccatcgcttcggcctccaccttctttggcggctctcgg
agcagcggctcggcacgcagagctcgcgcccacgacgtggagatggtgggccagcttgtc
ggtatcatggtggtgtcgtgcatctgctggagcccaatgctggtgttggtggcgctggcc
gtcggcggctggagctctacctccctgcagcggccactgttcctggccgtgcgccttgcc
tcctggaaccagatcctggacccttgggtgtacatcctactgcgccaggccgtgctgcgc
caactgcttcgcctcttgcccccgagggccggagccaagggcggccccgcggggctgggc
ctaacaccgagcgcctgggaggccagctcgctgcgcagctcccggcacagcggcctcagc
cacttctaa

DBGET integrated database retrieval system