KEGG   Homo sapiens (human): 5732Help
Entry
5732              CDS       T01001                                 

Gene name
PTGER2, EP2
Definition
(RefSeq) prostaglandin E receptor 2
  KO
K04259  
prostaglandin E receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Renin secretion
Pathways in cancer
Drug target
Butaprost: 
Dinoprostone (DG00448): 
Enprostil: 
Evatanepag (DG01894): 
Misoprostol: 
Rioprostil: 
Sulprostone: 
Taprenepag (DG01895): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    5732 (PTGER2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5732 (PTGER2)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    5732 (PTGER2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5732 (PTGER2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5732 (PTGER2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5732 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q22
AA seq 358 aa AA seqDB search
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcccagtctgaggactgcgagacgcgacagtggcttccc
ccaggcgaaagcccagccatcagctccgtcatgttctcggccggggtgctggggaacctc
atagcactggcgctgctggcgcgccgctggcggggggacgtggggtgcagcgccggccgc
aggagctccctctccttgttccacgtgctggtgaccgagctggtgttcaccgacctgctc
gggacctgcctcatcagcccagtggtactggcttcgtacgcgcggaaccagaccctggtg
gcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcctgtcatc
tatgcagtctccctgctcttctgctcgctgccgctgctggactatgggcagtacgtccag
tactgccccgggacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtac
gccaccctgctgctgcttctcattgtctcggtgctcgcctgcaacttcagtgtcattctc
aacctcatccgcatgcaccgccgaagccggagaagccgctgcggaccttccctgggcagt
ggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacg
gaccacctcattctcctggctatcatgaccatcaccttcgccgtctgctccttgcctttc
acgatttttgcatatatgaatgaaacctcttcccgaaaggaaaaatgggacctccaagct
cttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcct
cctgttctgagactaatgcgttcagtcctctgttgtcggatttcattaagaacacaagat
gcaacacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttga

DBGET integrated database retrieval system