KEGG   Homo sapiens (human): 5733Help
Entry
5733              CDS       T01001                                 

Gene name
PTGER3, EP3, EP3-I, EP3-II, EP3-III, EP3-IV, EP3e, PGE2-R
Definition
prostaglandin E receptor 3 (subtype EP3)
Orthology
K04260  
prostaglandin E receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5733 (PTGER3)
   04024 cAMP signaling pathway
    5733 (PTGER3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5733 (PTGER3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    5733 (PTGER3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.2
AA seq 390 aa AA seqDB search
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacccggggctacggaggggatgcccccttctgcacccgcctcaaccactcc
tacacaggcatgtgggcgcccgagcgttccgccgaggcgcggggcaacctcacgcgccct
ccagggtctggcgaggattgcggatcggtgtccgtggccttcccgatcaccatgctgctc
actggtttcgtgggcaacgcactggccatgctgctcgtgtcgcgcagctaccggcgccgg
gagagcaagcgcaagaagtccttcctgctgtgcatcggctggctggcgctcaccgacctg
gtcgggcagcttctcaccaccccggtcgtcatcgtcgtgtacctgtccaagcagcgttgg
gagcacatcgacccgtcggggcggctctgcacctttttcgggctgaccatgactgttttc
gggctctcctcgttgttcatcgccagcgccatggccgtcgagcgggcgctggccatcagg
gcgccgcactggtatgcgagccacatgaagacgcgtgccacccgcgctgtgctgctcggc
gtgtggctggccgtgctcgccttcgccctgctgccggtgctgggcgtgggccagtacacc
gtccagtggcccgggacgtggtgcttcatcagcaccgggcgagggggcaacgggactagc
tcttcgcataactggggcaaccttttcttcgcctctgcctttgccttcctggggctcttg
gcgctgacagtcaccttttcctgcaacctggccaccattaaggccctggtgtcccgctgc
cgggccaaggccacggcatctcagtccagtgcccagtggggccgcatcacgaccgagacg
gccattcagcttatggggatcatgtgcgtgctgtcggtctgctggtctccgctcctgata
atgatgttgaaaatgatcttcaatcagacatcagttgagcactgcaagacacacacggag
aagcagaaagaatgcaacttcttcttaatagctgttcgcctggcttcactgaaccagatc
ttggatccttgggtttacctgctgttaagaaagatccttcttcgaaagttttgccagatc
aggtaccacacaaacaactatgcatccagctccacctccttaccctgccagtgttcctca
accttgatgtggagcgaccatttggaaagatga

DBGET integrated database retrieval system