KEGG   Homo sapiens (human): 57380Help
Entry
57380             CDS       T01001                                 

Gene name
MRS2, HPT, MRS2L
Definition
(RefSeq) MRS2 magnesium transporter
  KO
K16075  
magnesium transporter
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.3-p22.1
AA seq 446 aa AA seqDB search
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRL
RVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRF
QHVMSITVRNNRIIMRMEKYSLLLESVASILQNSVSFMERQTEQWLFRELPSQLSGEGQL
VTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQN
GKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLE
NYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGV
AFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLL
ADRSMELKNSLRLDGLGSGRSILTNR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcctgcgcagtttaccctgcctcctgccccgcgcgatgagacttccccggcgg
acgctgtgtgccctggccttggacgtgacctctgtgggtcctcccgttgctgcctgcggc
cgccgagccaacctgattggaaggagccgagcggcgcagctttgcgggcccgaccggctc
cgcgtggcaggtgaagtgcaccggtttagaacctctgacgtctctcaagccactttagcc
agtgtagccccagtatttactgtgacaaaatttgacaaacagggaaacgttacttctttt
gaaaggaagaaaactgaattataccaagagttaggtcttcaagccagagatttgagattt
cagcatgtaatgagtatcacagtcagaaacaataggattatcatgagaatggagaaatat
tctctactcttggaatcagtagctagcattcttcaaaacagtgtctctttcatggagaga
cagacagagcaatggctgttccgggaactcccttcacagttgtctggagagggtcaactc
gttacataccctttaccttttgagtttagagctatagaagcactcctgcaatattggatc
aacacccttcaggggaaacttagcattttgcagccactgatccttgagaccttggatgct
ttggtggaccccaaacattcttctgtagacagaagcaaactgcacattttactacagaat
ggcaaaagtctatcagagttagaaacagatattaaaattttcaaagagtcaattttggag
atcttggatgaggaagagttgctagaagagctctgtgtatcaaaatggagtgacccacaa
gtctttgaaaagagcagtgctgggattgaccatgcagaagagatggagttgctgttggaa
aactactaccgattggctgacgatctctccaatgcagctcgtgagcttagggtgctgatt
gatgattcacaaagtattattttcattaatctggacagccaccgaaacgtgatgatgagg
ttgaatctacagctgaccatgggaaccttctctctttcgctctttggactaatgggagtt
gcttttggaatgaatttggaatcttcccttgaagaggaccatagaattttttggctgatt
acaggaattatgttcatgggaagtggcctcatctggaggcgcctgctttcattccttgga
cgacagctagaagctccattgcctcctatgatggcttctttacctaaaaagactcttctg
gcagatagaagcatggaattgaaaaatagcctcagactggatggacttggatcaggaagg
agcatcctaacaaaccgttag

DBGET integrated database retrieval system