KEGG   Homo sapiens (human): 57380Help
Entry
57380             CDS       T01001                                 

Gene name
MRS2, HPT, MRS2L
Definition
MRS2 magnesium transporter
Orthology
K16075  
magnesium transporter
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.3-p22.1
AA seq 446 aa AA seqDB search
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRL
RVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRF
QHVMSITVRNNRIIMRMEKYSLLLESVASILQNSVSFMERQTEQWLFRELPSQLSGEGQL
VTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQN
GKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLE
NYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGV
AFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLL
ADRSMELKNSLRLDGLGSGRSILTNR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcctgcgcagtttaccctgcctcctgccccgcgcgatgagacttccccggcgg
acgctgtgtgccctggccttggacgtgacctctgtgggtcctcccgttgctgcctgcggc
cgccgagccaacctgattggaaggagccgagcggcgcagctttgcgggcccgaccggctc
cgcgtggcaggtgaagtgcaccggtttagaacctctgacgtctctcaagccactttagcc
agtgtagccccagtatttactgtgacaaaatttgacaaacagggaaacgttacttctttt
gaaaggaagaaaactgaattataccaagagttaggtcttcaagccagagatttgagattt
cagcatgtaatgagtatcacagtcagaaacaataggattatcatgagaatggagaaatat
tctctactcttggaatcagtagctagcattcttcaaaacagtgtctctttcatggagaga
cagacagagcaatggctgttccgggaactcccttcacagttgtctggagagggtcaactc
gttacataccctttaccttttgagtttagagctatagaagcactcctgcaatattggatc
aacacccttcaggggaaacttagcattttgcagccactgatccttgagaccttggatgct
ttggtggaccccaaacattcttctgtagacagaagcaaactgcacattttactacagaat
ggcaaaagtctatcagagttagaaacagatattaaaattttcaaagagtcaattttggag
atcttggatgaggaagagttgctagaagagctctgtgtatcaaaatggagtgacccacaa
gtctttgaaaagagcagtgctgggattgaccatgcagaagagatggagttgctgttggaa
aactactaccgattggctgacgatctctccaatgcagctcgtgagcttagggtgctgatt
gatgattcacaaagtattattttcattaatctggacagccaccgaaacgtgatgatgagg
ttgaatctacagctgaccatgggaaccttctctctttcgctctttggactaatgggagtt
gcttttggaatgaatttggaatcttcccttgaagaggaccatagaattttttggctgatt
acaggaattatgttcatgggaagtggcctcatctggaggcgcctgctttcattccttgga
cgacagctagaagctccattgcctcctatgatggcttctttacctaaaaagactcttctg
gcagatagaagcatggaattgaaaaatagcctcagactggatggacttggatcaggaagg
agcatcctaacaaaccgttag

DBGET integrated database retrieval system