KEGG   Homo sapiens (human): 57380Help
Entry
57380             CDS       T01001                                 

Gene name
MRS2, HPT, MRS2L
Definition
(RefSeq) MRS2, magnesium transporter
  KO
K16075  
magnesium transporter
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   57380 (MRS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.3-p22.1
AA seq 443 aa AA seqDB search
MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRL
RVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRF
QHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTY
PLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKS
LSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYY
RLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFG
MNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADR
SMELKNSLRLDGLGSGRSILTNR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcctgcgcagtttaccctgcctcctgccccgcgcgatgagacttccccggcgg
acgctgtgtgccctggccttggacgtgacctctgtgggtcctcccgttgctgcctgcggc
cgccgagccaacctgattggaaggagccgagcggcgcagctttgcgggcccgaccggctc
cgcgtggcaggtgaagtgcaccggtttagaacctctgacgtctctcaagccactttagcc
agtgtagccccagtatttactgtgacaaaatttgacaaacagggaaacgttacttctttt
gaaaggaagaaaactgaattataccaagagttaggtcttcaagccagagatttgagattt
cagcatgtaatgagtatcacagtcagaaacaataggattatcatgagaatggagtatttg
aaagctgtgataactccagagtgtcttctgatattagattatcgtaatttaaacttagag
caatggctgttccgggaactcccttcacagttgtctggagagggtcaactcgttacatac
cctttaccttttgagtttagagctatagaagcactcctgcaatattggatcaacaccctt
caggggaaacttagcattttgcagccactgatccttgagaccttggatgctttggtggac
cccaaacattcttctgtagacagaagcaaactgcacattttactacagaatggcaaaagt
ctatcagagttagaaacagatattaaaattttcaaagagtcaattttggagatcttggat
gaggaagagttgctagaagagctctgtgtatcaaaatggagtgacccacaagtctttgaa
aagagcagtgctgggattgaccatgcagaagagatggagttgctgttggaaaactactac
cgattggctgacgatctctccaatgcagctcgtgagcttagggtgctgattgatgattca
caaagtattattttcattaatctggacagccaccgaaacgtgatgatgaggttgaatcta
cagctgaccatgggaaccttctctctttcgctctttggactaatgggagttgcttttgga
atgaatttggaatcttcccttgaagaggaccatagaattttttggctgattacaggaatt
atgttcatgggaagtggcctcatctggaggcgcctgctttcattccttggacgacagcta
gaagctccattgcctcctatgatggcttctttacctaaaaagactcttctggcagataga
agcatggaattgaaaaatagcctcagactggatggacttggatcaggaaggagcatccta
acaaaccgttag

DBGET integrated database retrieval system