KEGG   Homo sapiens (human): 5740Help
Entry
5740              CDS       T01001                                 

Gene name
PTGIS, CYP8, CYP8A1, PGIS, PTGI
Definition
(RefSeq) prostaglandin I2 (prostacyclin) synthase (EC:5.3.99.4)
  KO
K01831  
prostacyclin synthase [EC:5.3.99.4]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    5740 (PTGIS)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.4  prostaglandin-I synthase
     5740 (PTGIS)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP8 family
   5740 (PTGIS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.13
AA seq 500 aa AA seqDB search
MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDAASFLTRMKEK
HGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDE
KARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLRAGYLTL
YGIEALPRTHESQAQDRVHSADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKL
LSPARLARRAHRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLL
KNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLRLTAAPFITRE
VVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTDPEVFKYNRFLNPDGSEKKDF
YKDGKRLKNYNMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSR
YGFGLMQPEHDVPVRYRIRP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggccgcgctcctcggcctcctggccgcactgttgctgctgctgctactgagc
cgccgccgcacgcggcgacctggtgagcctcccctggacctgggcagcatcccctggttg
gggtatgccttggactttggaaaagatgctgccagcttcctcacgaggatgaaggagaag
cacggtgacatctttactatactggttgggggcaggtatgtcaccgttctcctggaccca
cactcctacgacgcggtggtgtgggagcctcgcaccaggctcgacttccatgcctatgcc
atcttcctcatggagaggatttttgatgtgcagcttccacattacagccccagtgatgaa
aaggccaggatgaaactgactcttctccacagagagctccaggcactcacagaagccatg
tataccaacctccatgcagtgctgttgggcgatgctacagaagcaggcagtggctggcac
gagatgggtctcctcgacttctcctacagcttcctgctcagagccggctacctgactctt
tacggaattgaggcgctgccacgcacccatgaaagccaggcccaggaccgcgtccactca
gctgatgtcttccacacctttcgccagctcgaccggctgctccccaaactggcccgtggc
tccctgtcagtgggggacaaggaccacatgtgcagtgtcaaaagtcgcctgtggaagctg
ctatccccagccaggctggccaggcgggcccaccggagcaaatggctggagagttacctg
ctgcacctggaggagatgggtgtgtcagaggagatgcaggcacgggccctggtgctgcag
ctgtgggccacacaggggaatatgggtcccgctgccttctggctcctgctcttccttctc
aagaatcctgaagccctggctgctgtccgcggagagctcgagagtatcctttggcaagcg
gagcagcctgtctcgcagacgaccactctcccacagaaggttctagacagcacacctgtg
cttgatagcgtgctgagtgagagcctcaggcttacagctgcccccttcatcacccgcgag
gttgtggtggacctggccatgcccatggcagacgggcgagaattcaacctgcgacgtggt
gaccgcctcctcctcttccccttcctgagcccccagagagacccagaaatctacacagac
ccagaggtatttaaatacaaccgattcctgaaccctgacggatcagagaagaaagacttt
tacaaggatgggaaacggctgaagaattacaacatgccctggggggcggggcacaatcac
tgcctggggaggagttatgcggtcaacagcatcaaacaatttgtgttccttgtgctggtg
cacttggacttggagctgatcaacgcagatgtggagatccctgagtttgacctcagcagg
tacggcttcggtctgatgcagccggaacacgacgtgcccgtccgctaccgcatccgccca
tga

DBGET integrated database retrieval system