KEGG   Homo sapiens (human): 57403Help
Entry
57403             CDS       T01001                                 

Gene name
RAB22A
Definition
(RefSeq) RAB22A, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    57403 (RAB22A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    57403 (RAB22A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    57403 (RAB22A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_16 AAA_24 Maelstrom AAA_5 NTPase_1
Motif
Other DBs
NCBI-GeneID: 57403
NCBI-ProteinID: NP_065724
OMIM: 612966
HGNC: 9764
Ensembl: ENSG00000124209
Vega: OTTHUMG00000032844
Pharos: Q9UL26(Tbio)
UniProt: Q9UL26
Position
20q13.32
AA seq 194 aa AA seqDB search
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKC
DLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGF
KLRRQPSEPKRSCC
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagggagctcaaagtgtgtctgctcggggatacaggtgtaggtaaatcgagt
attgtgtggcggtttgtggaagacagttttgatccaaacatcaacccaacaataggggca
tcttttatgaccaagactgtccagtaccaaaatgagctacataaattcctaatctgggat
acagctggacaagaacgatttcgtgccttagcaccaatgtactatcgagggtcggctgca
gctataatcgtttatgatatcacaaaagaagagacattttcaacattaaagaattgggtg
aaagagcttcgacagcatggcccacctaatattgtagttgccattgcaggaaataaatgt
gatcttatcgatgtaagagaagtcatggagagagatgcaaaggactacgccgactctatt
catgcaatttttgtagagaccagcgcaaaaaacgcgataaacataaatgaactctttata
gaaattagtcgaagaattccatccactgacgccaacctgccatctggcggtaagggcttc
aaactccgaagacagccttcagagccaaagcggagctgctgctga

DBGET integrated database retrieval system