KEGG   Homo sapiens (human): 57403Help
Entry
57403             CDS       T01001                                 

Gene name
RAB22A
Definition
RAB22A, member RAS oncogene family
Orthology
K07891  
Ras-related protein Rab-22
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    57403 (RAB22A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    57403 (RAB22A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.32
AA seq 194 aa AA seqDB search
MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWD
TAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKC
DLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGF
KLRRQPSEPKRSCC
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgagggagctcaaagtgtgtctgctcggggatacaggtgtaggtaaatcgagt
attgtgtggcggtttgtggaagacagttttgatccaaacatcaacccaacaataggggca
tcttttatgaccaagactgtccagtaccaaaatgagctacataaattcctaatctgggat
acagctggacaagaacgatttcgtgccttagcaccaatgtactatcgagggtcggctgca
gctataatcgtttatgatatcacaaaagaagagacattttcaacattaaagaattgggtg
aaagagcttcgacagcatggcccacctaatattgtagttgccattgcaggaaataaatgt
gatcttatcgatgtaagagaagtcatggagagagatgcaaaggactacgccgactctatt
catgcaatttttgtagagaccagcgcaaaaaacgcgataaacataaatgaactctttata
gaaattagtcgaagaattccatccactgacgccaacctgccatctggcggtaagggcttc
aaactccgaagacagccttcagagccaaagcggagctgctgctga

DBGET integrated database retrieval system