KEGG   Homo sapiens (human): 57406Help
Entry
57406             CDS       T01001                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    57406 (ABHD6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     57406 (ABHD6)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S33
   57406 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BV23(Tchem)
UniProt: 
Position
3p14.3
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcggcacgctggccatcccaatc
ctggcatttgtggcttcatttcttctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctgggcacaaaccctccatcctcatgctccacggattc
tctgcccacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggcaccacccgctcctccctggatgacctgtcc
atagatgggcaagttaagaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccaggtggctggggtgtatgctgcttac
tacccatcggatgtctccagcctgtgtctcgtgtgtcctgctggcctgcagtactcaact
gacaatcaatttgtacaacggctcaaagaactgcagggctctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgtcgatgtccgcatccctcataac
aacttctaccgaaagttgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggttccgacgcagatcatctgggggaaacaagaccaggtg
ctggatgtgtctggggcagacatgttggccaagtcaattgccaactgccaggtggagctt
ctggaaaactgtgggcactcagtagtgatggaaagacccaggaagacagccaagctcata
atcgactttttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system