KEGG   Homo sapiens (human): 5745Help
Entry
5745              CDS       T01001                                 

Gene name
PTH1R, PFE, PTHR, PTHR1
Definition
(RefSeq) parathyroid hormone 1 receptor
  KO
K04585  
parathyroid hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Endocrine and other factor-regulated calcium reabsorption
Disease
H00479  
Metaphyseal dysplasias
H00495  
Eiken dysplasia
H00508  
Blomstrand syndrome
H00680  
Primary failure of tooth eruption
Drug target
Teriparatide [DG:DG00512]: 
Parathyroid hormone: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5745 (PTH1R)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5745 (PTH1R)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    5745 (PTH1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p22-p21.1
AA seq 593 aa AA seqDB search
MGTARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPA
SIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETRE
REVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVK
DAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGNKK
WIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH
YIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKP
GTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcccggatcgcacccggcctggcgctcctgctctgctgccccgtgctcagc
tccgcgtacgcgctggtggatgcagatgacgtcatgactaaagaggaacagatcttcctg
ctgcaccgtgctcaggcccagtgcgaaaaacggctcaaggaggtcctgcagaggccagcc
agcataatggaatcagacaagggatggacatctgcgtccacatcagggaagcccaggaaa
gataaggcatctgggaagctctaccctgagtctgaggaggacaaggaggcacccactggc
agcaggtaccgagggcgcccctgtctgccggaatgggaccacatcctgtgctggccgctg
ggggcaccaggtgaggtggtggctgtgccctgtccggactacatttatgacttcaatcac
aaaggccatgcctaccgacgctgtgaccgcaatggcagctgggagctggtgcctgggcac
aacaggacgtgggccaactacagcgagtgtgtcaaatttctcaccaatgagactcgtgaa
cgggaggtgtttgaccgcctgggcatgatttacaccgtgggctactccgtgtccctggcg
tccctcaccgtagctgtgctcatcctggcctactttaggcggctgcactgcacgcgcaac
tacatccacatgcacctgttcctgtccttcatgctgcgcgccgtgagcatcttcgtcaag
gacgctgtgctctactctggcgccacgcttgatgaggctgagcgcctcaccgaggaggag
ctgcgcgccatcgcccaggcgcccccgccgcctgccaccgccgctgccggctacgcgggc
tgcagggtggctgtgaccttcttcctttacttcctggccaccaactactactggattctg
gtggaggggctgtacctgcacagcctcatcttcatggccttcttctcagagaagaagtac
ctgtggggcttcacagtcttcggctggggtctgcccgctgtcttcgtggctgtgtgggtc
agtgtcagagctaccctggccaacaccgggtgctgggacttgagctccgggaacaaaaag
tggatcatccaggtgcccatcctggcctccattgtgctcaacttcatcctcttcatcaat
atcgtccgggtgctcgccaccaagctgcgggagaccaacgccggccggtgtgacacacgg
cagcagtaccggaagctgctcaaatccacgctggtgctcatgcccctctttggcgtccac
tacattgtcttcatggccacaccatacaccgaggtctcagggacgctctggcaagtccag
atgcactatgagatgctcttcaactccttccagggattttttgtcgcaatcatatactgt
ttctgcaatggcgaggtacaagctgagatcaagaaatcttggagccgctggacactggca
ctggacttcaagcgaaaggcacgcagcgggagcagcagctatagctacggccccatggtg
tcccacacaagtgtgaccaatgtcggcccccgtgtgggactcggcctgcccctcagcccc
cgcctactgcccactgccaccaccaacggccaccctcagctgcctggccatgccaagcca
gggaccccagccctggagaccctcgagaccacaccacctgccatggctgctcccaaggac
gatgggttcctcaacggctcctgctcaggcctggacgaggaggcctctgggcctgagcgg
ccacctgccctgctacaggaagagtgggagacagtcatgtga

DBGET integrated database retrieval system