KEGG   Homo sapiens (human): 574537Help
Entry
574537            CDS       T01001                                 

Gene name
UGT2A2
Definition
UDP glucuronosyltransferase 2 family, polypeptide A2 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574537 (UGT2A2)
   00053 Ascorbate and aldarate metabolism
    574537 (UGT2A2)
   00500 Starch and sucrose metabolism
    574537 (UGT2A2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    574537 (UGT2A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574537 (UGT2A2)
   00860 Porphyrin and chlorophyll metabolism
    574537 (UGT2A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574537 (UGT2A2)
   00982 Drug metabolism - cytochrome P450
    574537 (UGT2A2)
   00983 Drug metabolism - other enzymes
    574537 (UGT2A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    574537 (UGT2A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574537 (UGT2A2)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   574537 (UGT2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
UniProt: 
Position
4q13.3
AA seq 536 aa AA seqDB search
MVSIRDFTMPKKFVQMLVFNLTLTEVVLSGNVLIWPTDGSHWLNIKIILEELIQRNHNVT
VLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKEL
GKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTL
RFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWN
SYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
EFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQL
FDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
EVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGA
KHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtttccataagggattttaccatgcctaagaagtttgtccagatgctggtttttaat
ttgactctgactgaagttgttctaagtgggaatgtgttaatttggcctacagatggtagc
cattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtgact
gtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaatttt
gaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatgata
atgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaacta
ggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtactaaag
aacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagaccca
gtaacaatctgtggtgatcttgttgctctgaaattaggaattccatttatgtacacattg
aggttctctccagcatcaacagtggagagacactgtgggaaaatcccagcaccagtctcc
tatgtaccggcagccttatcagagctcactgaccagatgacctttggtgaaaggattaaa
aataccatatcttattctctgcaagactatatatttcagtcctactggggagaatggaat
tcatactatagcaaaattttaggaagacccactacgttatgtgagactatggggaaagct
gaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacctaat
tttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggaaatggaa
gaatttatccagagctcaggtaaaaatggtgttgtggtgttttctctgggatcaatggtc
aaaaaccttacagaagaaaaggccaatcttattgcctcagcccttgcccagattccacag
aaggttttatggagatacaaaggaaagaaaccagccacattaggaaacaatactcagctc
tttgattggataccccagaatgatcttcttggacatcccaaaaccaaagcttttatcact
catggtggaactaatgggatctacgaagctatttaccacggagtccctatggtgggagtt
cccatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagctgtg
gaagtgaacctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtcatt
aatgaaccttcttataaagagaatgctatgaggttatcaagaattcaccatgatcaacct
gtaaagcccctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagcc
aagcaccttcgggttgcagcccatgacctcacctggttccagtaccactctttggatgta
attgggttcttgctggtctgtgtgacaacggctatatttttggtcatacaatgttgtttg
ttttcctgtcaaaaatttggtaagataggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system