KEGG   Homo sapiens (human): 574537Help
Entry
574537            CDS       T01001                                 

Gene name
UGT2A2
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member A2
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574537 (UGT2A2)
   00053 Ascorbate and aldarate metabolism
    574537 (UGT2A2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    574537 (UGT2A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574537 (UGT2A2)
   00860 Porphyrin and chlorophyll metabolism
    574537 (UGT2A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574537 (UGT2A2)
   00982 Drug metabolism - cytochrome P450
    574537 (UGT2A2)
   00983 Drug metabolism - other enzymes
    574537 (UGT2A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    574537 (UGT2A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574537 (UGT2A2)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   574537 (UGT2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 574537
NCBI-ProteinID: NP_001099147
HGNC: 28183
Ensembl: ENSG00000271271
Vega: OTTHUMG00000129398
Pharos: Q9Y4X1(Tdark)
UniProt: Q9Y4X1
Position
4q13.3
AA seq 536 aa AA seqDB search
MVSIRDFTMPKKFVQMLVFNLTLTEVVLSGNVLIWPTDGSHWLNIKIILEELIQRNHNVT
VLASSATLFINSNPDSPVNFEVIPVSYKKSNIDSLIEHMIMLWIDHRPTPLTIWAFYKEL
GKLLDTFFQINIQLCDGVLKNPKLMARLQKGGFDVLVADPVTICGDLVALKLGIPFMYTL
RFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGERIKNTISYSLQDYIFQSYWGEWN
SYYSKILGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEME
EFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQL
FDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAV
EVNLNTMTSVDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGA
KHLRVAAHDLTWFQYHSLDVIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggtttccataagggattttaccatgcctaagaagtttgtccagatgctggtttttaat
ttgactctgactgaagttgttctaagtgggaatgtgttaatttggcctacagatggtagc
cattggttaaatattaagattattctagaagagttgattcaaagaaatcacaatgtgact
gtactggcttcatcagcaactctattcatcaactccaatcccgattctcctgtgaatttt
gaagtgatacctgtttcctacaagaagagcaatatagattccttaattgagcatatgata
atgctgtggattgaccatagaccaactcctctcacaatatgggctttctacaaagaacta
ggaaaacttctagacactttctttcaaattaacatacaactctgtgatggtgtactaaag
aacccaaagttgatggcaagacttcagaaaggtggttttgatgtgttggtagcagaccca
gtaacaatctgtggtgatcttgttgctctgaaattaggaattccatttatgtacacattg
aggttctctccagcatcaacagtggagagacactgtgggaaaatcccagcaccagtctcc
tatgtaccggcagccttatcagagctcactgaccagatgacctttggtgaaaggattaaa
aataccatatcttattctctgcaagactatatatttcagtcctactggggagaatggaat
tcatactatagcaaaattttaggaagacccactacgttatgtgagactatggggaaagct
gaaatttggttaatccgaacatattgggattttgaatttcctcgtccatacttacctaat
tttgagtttgttggaggattgcactgcaaacctgccaaacctttacctaaggaaatggaa
gaatttatccagagctcaggtaaaaatggtgttgtggtgttttctctgggatcaatggtc
aaaaaccttacagaagaaaaggccaatcttattgcctcagcccttgcccagattccacag
aaggttttatggagatacaaaggaaagaaaccagccacattaggaaacaatactcagctc
tttgattggataccccagaatgatcttcttggacatcccaaaaccaaagcttttatcact
catggtggaactaatgggatctacgaagctatttaccacggagtccctatggtgggagtt
cccatgtttgctgatcagcctgataacattgctcacatgaaggccaaaggagcagctgtg
gaagtgaacctaaacacaatgacaagtgtggatttgcttagcgctttgagaacagtcatt
aatgaaccttcttataaagagaatgctatgaggttatcaagaattcaccatgatcaacct
gtaaagcccctggatcgagcagtcttctggatcgagtttgtcatgcgccacaaaggagcc
aagcaccttcgggttgcagcccatgacctcacctggttccagtaccactctttggatgta
attgggttcttgctggtctgtgtgacaacggctatatttttggtcatacaatgttgtttg
ttttcctgtcaaaaatttggtaagataggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system