KEGG   Homo sapiens (human): 57455Help
Entry
57455             CDS       T01001                                 

Gene name
REXO1, ELOABP1, EloA-BP1, REX1, TCEB3BP1
Definition
(RefSeq) RNA exonuclease 1 homolog
  KO
K14570  
RNA exonuclease 1 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    57455 (REXO1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     57455 (REXO1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    57455 (REXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8N1G1(Tdark)
UniProt: 
Position
19p13.3
AA seq 1221 aa AA seqDB search
MLRSTGFFRAIDCPYWSGAPGGPCRRPYCHFRHRGARGSGAPGDGGEAPPAAGLGYDPYN
PELPKPPAQRENGTLGLGEEPRPDVLELELVNQAIEAVRSEVELEQRRYRELLETTREHR
SAEAPALAPRGPNASPTVGPDEDAFPLAFDYSPGSHGLLSPDAGYQPTPLAAPAEPGSKY
SLASLDRGQGRGGGGGGALEYVPKAVSQPRRHSRPVPSGKYVVDNSRPPTDLEYDPLSNY
SARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNE
PTTASTPKARADPEIKATGQPPSKEGLEAEGGGLRETKETAVQCDVGDLQPPPAKPASPA
QVQSSQDGGCPKEGKPKKKKTGAPPAPSCKDGAQGKDKTKDKGRGRPVEKPRADKKGPQA
SSPRRKAERPEGTKKKPSSATPVATSGKGRPDRPARRPSPTSGDSRPAAGRGPPRPLQLP
DRKSTKAPSGKLVERKARSLDEGASQDAPKLKKRALSHADLFGDESEDEAAGPGVPSVWP
SALPSLSSDSDSDSDSSLGFPEAQGPPKRLKASPPPSPAPSSSSSSSSSTSSAGADVDYS
ALEKEVDFDSDPMEECLRIFNESTSVKTEDRGRLARQPPKEEKSEEKGLSGLTTLFPGQK
RRISHLSKQGQEVEPPRRGPAVPPARPPTAQEVCYLRAQQAQRASASLLQAPARLAEKSP
SVHISAPGEKRRIAHIPNPRLAAAPTGAKRTLAASGSQSSNGPEPGGQQLKTRTLSGMAS
KTTTTIIPKRIAHSPSLQSLKKPIIPKEFGGKVPTVIRQRYLNLFIEECLKFCTSNQEAI
EKALNEEKVAYDRSPSKNIYLNVAVNTLKKLRGLAPSAVPGLSKTSGRRVVSHEVVLGGR
LAAKTSFSLSRPSSPRVEDLKGAALYSRLREYLLTQDQLKENGYPFPHPERPGGAIIFTA
EEKRPKDSSCRTCCRCGTEYLVSSSGRCIRDEECYYHWGRLRRNRVAGGWETQYMCCSAA
AGSVGCQVAKQHVQDGRKERLEGFVKTFEKELSGDTHPGIYALDCEMSYTTYGLELTRVT
VVDTDVHVVYDTFVKPDNEIVDYNTRFSGVTEADLADTSVTLRDVQAVLLSMFSADTILI
GHSLESDLLALKVIHSTVVDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGHSSSE
DAGACMHLVIWKVREDAKTKR
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atgctacgctccactggcttcttccgggccattgactgcccctattggtctggggcgccc
ggggggccctgccggcggccctactgccacttccggcaccgcggggcccggggctccggc
gcgcccggtgacggcggagaggcgccccccgcagcagggctgggttacgacccctacaac
cctgagctgcccaagccccccgcgcagagggagaatggcaccctgggcctgggggaggag
ccgcgcccggatgtgctggagttggagctggtcaaccaggccatcgaggccgtgcgcagt
gaggtggagctggagcagcggcgctaccgggagctgctggagacgacccgtgagcaccgc
tccgccgaggcccccgccctggcgccccgcggccccaacgccagccccactgtgggcccg
gacgaggatgccttcccactggccttcgactacagccccggcagccacggcctattaagc
cctgatgccggctaccagcccaccccactggccgcccctgccgagccgggcagcaagtac
tcgctggcgtccctggacaggggtcagggcagaggtggagggggtggcggtgccctggaa
tacgtccccaaggctgtgagccagccccggcggcacagccgccccgttcccagtggcaag
tacgtggtggacaactccaggccacccacagacctggagtatgaccctctctccaactac
tcggcccggcacctcagcagggccagctcccgggatgagcgggccgccaagcggccccgg
ggctcccgcggcagtgagccctacacacctgctcccaagaagctctgtgacccctttggc
agttgcgatgcaaggttctcagactcagaagatgaggccgccacggtcccaggtaacgag
cccaccacggccagcacccccaaagccagggccgaccctgagatcaaggccaccgggcag
ccaccctccaaagagggcctggaggccgaggggggcggcctgcgggagaccaaggagacg
gccgtgcagtgcgacgtgggggacctccagccgcccccagccaagcccgcctccccagcc
caggtccagtcctcacaggatgggggctgccccaaggagggaaaacccaagaagaaaaaa
accggggccccacctgcccccagctgcaaagacggggcccaggggaaggacaagaccaag
gacaagggccgagggcggcctgtggagaagccccgtgcggacaagaagggcccgcaggcc
agcagcccccggcgcaaggcagagcggccggaagggaccaagaagaagccatcttcggcc
actcctgtggccacctcagggaaagggaggcctgaccggccagcgcggcggccgagcccc
acaagcggggactcccgaccggcggccggcagaggcccaccccgccccctccagctgccc
gacaggaagagcaccaaggccccgtcggggaagctagtggagcggaaagcccgctcacta
gacgagggcgcctcccaggacgcccccaagctgaagaagcgggccctgagccacgccgac
ctctttggggacgagagtgaggacgaggccgcagggccaggggtgccgagcgtgtggccc
tctgccctccccagcctcagctcggactcagactccgactcagactccagcctgggcttc
ccggaggcgcaggggccgcccaagcggctcaaggcctccccgcccccctcccccgcccca
tcctcctcctcctcctcctcctcctccacctccagcgcgggggcggatgtggactactcg
gccctggagaaggaggtggactttgactccgaccccatggaggagtgcctgcggatcttc
aacgagtccaccagcgtcaagacggaggacagaggccggctggcccggcagccccccaag
gaagagaagagtgaggagaaggggctttcgggtctgaccactctgttccccgggcagaag
aggaggatctcccacctttccaagcaaggccaggaggtggagcccccgaggaggggtccc
gcggtgcccccggcccggcccccgacggcgcaggaggtgtgctacctgcgggcccagcag
gcgcagagggcatcggcgagcttgctgcaggcccccgccaggctggcagagaagtcgccc
tccgtccacatttccgcccctggcgagaagaggaggatcgcccacatccccaacccccgc
ctggctgcagcccccacaggtgccaagaggacccttgcggccagcggcagccagtcctcc
aacggccctgagccaggtggccagcagctgaaaacacgcacattgtcggggatggcgtcc
aagactaccaccaccatcatccctaagcgaatcgcccacagtccatccttacagagttta
aagaaacccattatccccaaagagtttgggggcaaagtccccaccgtcatccgccagcgc
tatctcaacctgttcatcgaggagtgtctcaagttctgtacctccaaccaggaggccata
gagaaggcactgaacgaggagaaggtggcctatgaccgcagccccagcaagaacatctac
ctgaatgtggccgtgaacaccctcaagaagctcaggggcctggcccccagcgctgtgccc
ggcctcagcaaaaccagtggccgcagggttgtgtcccacgaggtggtgttggggggcagg
ttggccgccaagaccagcttctcgctcagccgtccaagcagcccccgggtggaggacctg
aaaggggctgccctgtacagccgcctcagggagtacctgctcacccaggaccagctcaag
gagaacggctaccccttcccgcacccagagcggcccgggggcgcaatcatcttcacagct
gaggagaagaggcccaaggactcttcctgcaggacctgctgccgctgtggcaccgagtac
ctcgtgtcctcttcaggccgctgcatccgggacgaggagtgttattaccactggggacgg
ctgcgccggaaccgggtggccggaggctgggagacccagtacatgtgctgctcggctgcc
gccggctctgtcggctgccaagtcgcaaagcaacacgtgcaggatggccggaaggagcgc
cttgagggcttcgtgaagacctttgagaaagagctctcaggagacacccacccggggatc
tacgccctggactgcgagatgtcctacaccacatatggcctggagctgacgcgcgtcacg
gtggtcgacacggacgtgcacgtggtttatgacaccttcgtgaagcctgacaacgagatc
gtggactacaacaccaggttttcgggggtgacggaggctgaccttgccgacacaagtgtc
acgctgcgtgacgtccaggccgttctgctgagcatgttcagcgctgacaccatcctcatc
ggacacagcctggagagcgacctcctggccctgaaggtcatccacagcaccgtggtggac
acgtctgtgctcttcccccaccgcctgggcctcccctacaagcggtccctgcggaacctc
atggccgactacctcagacagatcatccaggacaatgtggatgggcacagctccagcgag
gacgccggcgcctgcatgcacctggtgatctggaaggttcgagaagacgccaagaccaag
cgatga

DBGET integrated database retrieval system