KEGG   Homo sapiens (human): 57463Help
Entry
57463             CDS       T01001                                 

Gene name
AMIGO1, ALI2, AMIGO, AMIGO-1
Definition
(RefSeq) adhesion molecule with Ig like domain 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.3
AA seq 493 aa AA seqDB search
MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKV
WVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHN
FTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcacccccaccgtgacccgagaggcctctggctcctgctgccgtccttgtccctgctg
ctttttgaggtggccagagctggccgagccgtggttagctgtcctgccgcctgcttgtgc
gccagcaacatcctcagctgctccaagcagcagctgcccaatgtgccccattccttgccc
agttacacagcactactggacctcagtcacaacaacctgagccgcctgcgggccgagtgg
acccccacgcgcctgacccaactgcactccctgctgctgagccacaaccacctgaacttc
atctcctctgaggccttttccccggtacccaacctgcgctacctggacctctcctccaac
cagctgcgtacactggatgagttcctgttcagtgacctgcaagtactggaggtgctgctg
ctctacaataaccacatcatggcggtggaccggtgcgccttcgatgacatggcccagctg
cagaaactctacttgagccagaaccagatctctcgcttccctctggaactggtcaaggaa
ggagccaagctacccaaactaacgctcctggatctctcttctaacaagctgaagaacttg
ccattgcctgacctgcagaagctgccggcctggatcaagaatgggctgtacctacataac
aaccccctgaactgcgactgtgagctctaccagctgttttcacactggcagtatcggcag
ctgagctccgtgatggactttcaagaggatctgtactgcatgaactccaagaagctgcac
aatgtcttcaacctgagtttcctcaactgtggcgagtacaaggagcgtgcctgggaggcc
cacctgggtgacaccttgatcatcaagtgtgacaccaagcagcaagggatgaccaaggtg
tgggtgacaccaagtaatgaacgggtgctagatgaggtgaccaatggcacagtgagtgtg
tctaaggatggcagtcttcttttccagcaggtgcaggtcgaggacggtggtgtgtatacc
tgctatgccatgggagagactttcaatgagacactgtctgtggaattgaaagtgcacaat
ttcaccttgcacggacaccatgacaccctcaacacagcctataccaccctagtgggctgt
atccttagtgtggtcctggtcctcatatacctatacctcaccccttgccgctgctggtgc
cggggtgtagagaagccttccagccatcaaggagacagcctcagctcttccatgcttagt
accacacccaaccatgatcctatggctggtggggacaaagatgatggttttgaccggcgg
gtggctttcctggaacctgctggacctgggcagggtcaaaacggcaagctcaagccaggc
aacaccctgccagtgcctgaggccacaggcaagggccaacggaggatgtcggatccagaa
tcagtcagctcggtcttctctgatacgcccattgtggtgtga

DBGET integrated database retrieval system