KEGG   Homo sapiens (human): 57472Help
Entry
57472             CDS       T01001                                 

Gene name
CNOT6, CCR4
Definition
CCR4-NOT transcription complex, subunit 6 (EC:3.1.13.4)
Orthology
K12603  
CCR4-NOT transcription complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    57472 (CNOT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.3
AA seq 557 aa AA seqDB search
MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSD
NSLSRIPSDIAKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLF
QLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEP
DRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQE
VETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTV
EFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANA
HMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYT
NYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL
LLPFLPQVNGIHLPGRR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagaaaaatacgagccccctgaccctcggaggatgtatacaattatgtcttct
gaggaagcagcaaatggaaagaaatcccactgggcagagcttgaaataagtggaaaagta
agaagcttaagcgcatctttgtggtcactaactcacctgacagctttgcatttgagtgac
aattccctgtcccgaattccttcagacattgccaagcttcacaatctggtgtatttggac
ctgtcatctaataaaattcgtagcttacccgcagaactcggaaacatggtatcactcagg
gagctccatttaaataacaacctgttacgagttctaccttttgagctgggaaaactgttt
cagttgcagactttaggcctgaaaggaaatccccttacccaggatatattgaacctttat
caggaaccagatggaacaagacggctgctgaactatttgcttgataatttgtcaggtact
gcaaaaagaattacaacagaacaaccacctccaaggtcttggattatgttacaagaacca
gataggacaaggccaactgccttgttttctgtcatgtgctataatgttctttgtgataaa
tatgcgacccggcagttatacggctactgtccatcatgggcgctaaactgggactacagg
aaaaaggccattattcaagaaatcttgagctgcaatgctgatatcgtaagtcttcaggag
gttgaaacggaacagtattacagtttttttctggtagagctgaaagaacgtggctataat
ggattcttcagtcctaagtctagagctaggacaatgtcagaacaagaaaggaaacatgtt
gatggctgtgcaatattcttcaagacagaaaaatttactttggttcagaaacacactgtt
gaatttaatcagctagccatggcaaattctgaggggtctgaagctatgctgaacagagtc
atgacaaaagataacattggggttgcagtactgctagaacttcggaaggaatcgattgaa
atgccgtctggaaagccacatcttggaacagaaaaacaacttattcttgtggctaacgcc
cacatgcattgggaccctgaatactctgatgtgaagttggtacaaactatgatgttcctc
tcagaagtgaagaacattattgataaagcctctcgcaacctcaaatccagtgttttggga
gaatttggaactattccacttgtgttatgtgcagatcttaattctttgccagactctggt
gttgtagaatatttgagcacaggtggagtagaaacaaatcacaaagactttaaggagttg
aggtataatgaaagtctcacaaacttcagctgtcatgggaagaatggaaccaccaatgga
aggatcactcatggtttcaagttacagagtgcctatgagagtggcctgatgccttacacg
aattacacatttgatttcaagggtataatagactacattttctattctaaacctcagctg
aacaccttaggcatcctgggccctctggaccaccactggctggttgagaataacatcagt
ggctgcccgcaccccctcatcccctctgaccacttctcactttttgcacaactggagctc
ttactgcctttcctgccccaagtcaacggcatccaccttcctggcaggaggtag

DBGET integrated database retrieval system