KEGG   Homo sapiens (human): 57478Help
Entry
57478             CDS       T01001                                 

Gene name
USP31
Definition
ubiquitin specific peptidase 31 (EC:3.4.19.12)
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     57478 (USP31)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   57478 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.2
AA seq 1352 aa AA seqDB search
MSKVTAPGSGPPAAASGKEKRSFSKRLFRSGRAGGGGAGGPGASGPAAPSSPSSPSSARS
VGSFMSRVLKTLSTLSHLSSEGAAPDRGGLRSCFPPGPAAAPTPPPCPPPPASPAPPACA
AEPVPGVAGLRNHGNTCFMNATLQCLSNTELFAEYLALGQYRAGRPEPSPDPEQPAGRGA
QGQGEVTEQLAHLVRALWTLEYTPQHSRDFKTIVSKNALQYRGNSQHDAQEFLLWLLDRV
HEDLNHSVKQSGQPPLKPPSETDMMPEGPSFPVCSTFVQELFQAQYRSSLTCPHCQKQSN
TFDPFLCISLPIPLPHTRPLYVTVVYQGKCSHCMRIGVAVPLSGTVARLREAVSMETKIP
TDQIVLTEMYYDGFHRSFCDTDDLETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLN
HLKFGLDYHRLSSPTQTAAKQGKMDSPTSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLH
LEKTIAWDLLQKEILEKMKYFLRPTVCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPIVE
RALKSCGPGGTAHVKLVVEWDKETRDFLFVNTEDEYIPDAESVRLQRERHHQPQTCTLSQ
CFQLYTKEERLAPDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQN
MVKFPLTGLDMTPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQ
GGHYTAYCKNSVDGLWYCFDDSDVQQLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGS
TSSSLCEHWVSRLPGSKPASVTSAASSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRS
VQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIG
EAADDKVSISCFGSLRNLSSSYQEPSDSHSRREHKAVGRAPLAVMEGVFKDESDTRRLNS
SVVDTQSKHSAQGDRLPPLSGPFDNNNQIAYVDQSDSVDSSPVKEVKAPSHPGSLAKKPE
STTKRSPSSKGTSEPEKSLRKGRPALASQESSLSSTSPSSPLPVKVSLKPSRSRSKADSS
SRGSGRHSSPAPAQPKKESSPKSQDSVSSPSPQKQKSASALTYTASSTSAKKASGPATRS
PFPPGKSRTSDHSLSREGSRQSLGSDRASATSTSKPNSPRVSQARAGEGRGAGKHVRSSS
MASLRSPSTSIKSGLKRDSKSEDKGLSFFKSALRQKETRRSTDLGKTALLSKKAGGSSVK
SVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGV
PSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaacggcgcctgggtccgggccgccggcggcggcgagcgggaaggagaag
cgctccttcagcaagcggctgtttcggagcggccgcgctggcggcggcggcgcggggggc
cccggggcgtccgggccggccgcgccttcctcgccctcctcgccctcctctgcacgctcg
gtgggcagcttcatgagccgcgttctcaagacgctgtccacgctctcgcaccttagctct
gagggcgccgccccagaccgcggcggcctccgcagctgcttcccgcccgggccggccgcc
gcgcccacgccgccgccgtgcccgccgccgcccgcctctcccgcgccgcccgcttgcgcc
gccgagccggtgcccggcgtggcggggctccgcaaccacggcaacacgtgcttcatgaac
gccacgctgcagtgcctcagcaacaccgagctcttcgccgagtacctggcgctgggccag
taccgggcggggcggcccgagccctcgcctgacccggagcagcctgcgggccgcggcgcg
cagggccagggcgaggtcactgagcagctggcgcacctggtgcgggccctctggaccctg
gagtacaccccgcagcacagccgcgacttcaagactattgtgtcaaagaatgcactgcag
taccggggaaattcccaacatgatgcccaggagtttctgctgtggcttttggaccgagtt
catgaagacctcaaccattcagtgaagcagagtggccagcctcctctgaagccaccatca
gagactgatatgatgcctgagggaccatctttccctgtctgtagcacttttgtacaagaa
ctctttcaagcgcaatacagatcttctttgacgtgtcctcattgtcagaaacagagcaac
acttttgatcctttcctttgcatttctttgccaattcctctgccccacacaaggcctctc
tatgtcactgtagtgtatcaaggcaaatgttctcactgcatgaggattggtgtggccgta
cctctgtctgggactgtcgccagacttcgggaagcagtgtctatggaaacaaagatcccc
actgatcagattgtgttaacagaaatgtactatgatgggttccatcgttccttttgtgat
acagacgacctggaaacagtccatgaaagcgactgcatttttgcctttgagactcccgaa
atatttaggcctgaaggaattctcagtcaaagaggaattcatttaaacaacaacctaaac
cacttgaaatttggcttggattatcatagactgtcttctcctacacaaacagcagcaaag
caggggaaaatggattctcccacatcaagagcaggcagcgacaagattgtcctgttggtg
tgtaaccgagcctgcactgggcaacaagggaaaagatttggactgccttttgtgctgcac
ttagagaagacaatagcttgggaccttctgcagaaggaaatcttggagaagatgaagtat
ttcttgaggcccacggtttgcattcaggtgtgtccattcagcttgcgtgtggtcagtgtt
gttggaataacatatttgctgccccaggaggagcagcccttgtgccacccaatagtagaa
agggcattaaaatcttgtggaccaggtggcactgctcatgtgaaattagtagtcgagtgg
gacaaggagacaagagatttcttatttgtaaatactgaggatgagtatattcctgatgca
gaaagtgttcgtctgcaaagggagcgtcatcatcagcctcaaacctgcactttatcccag
tgtttccaactgtacaccaaagaggagcggcttgcccccgatgatgcctggcgttgccca
cactgtaagcagctgcagcagggaagcattacgttaagcctctggactctgcctgatgtg
cttattatacatctaaagagatttcggcaggaaggagacaggcgcatgaaacttcagaac
atggtcaaattccccttgactggcctggacatgacacctcacgtggttaagaggagccag
agcagctggagtttgccatcgcattggtccccgtggagacggccctatggactcgggagg
gaccctgaggactacatctatgacctgtatgctgtgtgcaatcaccatggcaccatgcaa
ggggggcactacacagcgtactgtaagaactctgtggacggcctctggtactgcttcgat
gacagcgatgtgcagcagctgtcagaagatgaggtctgcacgcagacagcatacatcctc
ttctaccagaggcggacagccatcccgtcatggtcagccaacagctcggtggcaggctcc
acaagttcttccctgtgtgaacactgggtgagccggctcccgggcagcaagccagccagc
gtgacctctgcagcttcctccagacgcacctccctggcgtcgctctctgagtccgtggag
atgactggagaaaggagtgaagatgatggaggcttttcaactcgaccatttgtgagaagt
gtccagcgtcagagtttgtcatccagatcttctgtcaccagccccttggccgtcaatgaa
aattgcatgagaccttcatggtccctgtctgctaagctgcagatgcgctccaattctcca
tcccgattttcaggggattcgccaattcacagctctgcttccaccttggagaagattggg
gaggcagcagatgacaaggtctccatctcttgctttggtagcttgcggaacctttctagc
agttaccaggaaccaagcgacagtcatagtcgccgtgagcacaaggctgtgggccgggcc
cctctggctgtcatggaaggcgtgttcaaagacgaatcggacacccgcagattgaactcc
agtgtcgtagatacacagagcaaacattcagcacaaggggaccgcctgcccccgctctct
ggtccatttgataacaataatcagatcgcttatgtggatcagagcgactccgtagacagc
tctccagtcaaagaggtgaaagcccccagccacccaggctcactcgcaaagaaaccagag
agcacaactaagagatcccccagttccaaaggcacttctgagccagagaaaagcttgcgg
aaggggagaccagccttggcaagccaggagtcatccctttcaagtacatccccttcttct
cctcttcctgtaaaagtctctctaaagccctcccgctcccgcagcaaagcagattcttct
tccaggggcagtggacggcattcatcccctgcccctgcccaacccaaaaaggagtcatcc
ccgaaatctcaggactccgtgtcatctccttcgccacagaagcagaagtcagcctcggcc
ctcacctacactgcttcctccacatctgccaaaaaggcctcgggccctgccacaaggagc
cctttcccacctgggaagagcaggacttcagaccacagcttgagtagagagggctccaga
caaagcttgggttctgacagagccagcgccacctccacctccaaacccaattcccctcgg
gtgagccaggcccgagcaggggagggcaggggggccgggaagcacgtgcggagctcctcc
atggccagcctgcgctcccccagcacaagcatcaagtctggtttgaagagggacagcaag
tctgaggacaaggggctgtccttcttcaaatcagccttgagacagaaggaaacccggcgc
tcgacggatcttggcaagacagccttgctctctaaaaaggctggtgggagctctgttaag
tctgtctgtaagaacaccggggacgacgaggcagagagaggccaccagcctccagcttcc
cagcagccaaatgcaaatacaacgggaaaagagcagcttgtcaccaaggaccctgcttct
gccaaacattccctgctgtccgctcgcaaatccaagtcttcccaactagactctggagtt
ccctcgtctccgggtggcaggcagtctgcagagaaatcctcaaaaaagttatcttctagc
atgcaaacctctgcacggccttctcaaaaacctcagtga

DBGET integrated database retrieval system