KEGG   Homo sapiens (human): 57486Help
Entry
57486             CDS       T01001                                 

Gene name
NLN, AGTBP, EP24.16, MEP, MOP
Definition
neurolysin (metallopeptidase M3 family) (EC:3.4.24.16)
Orthology
K01393  
neurolysin [EC:3.4.24.16]
Organism
hsa  Homo sapiens (human)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    57486 (NLN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     57486 (NLN)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M3
   57486 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q12.3
AA seq 704 aa AA seqDB search
MIARCLLAVRSLRRVGGSRILLRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTR
TEELIVQTKQVYDAVGMLGIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMRGDIFERIVHLQETCDLGKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYK
ITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHA
DFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWD
LYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPV
AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVD
SLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccggtgccttttggctgtgcgaagcctccgcagagttggtggttccaggatt
ttactcagaatgacgttaggaagagaagtgatgtctcctcttcaggcaatgtcttcctat
actgtggctggcagaaatgttttaagatgggatctttcaccagagcaaattaaaacaaga
actgaggagctcattgtgcagaccaaacaggtgtacgatgctgttggaatgctcggtatt
gaggaagtaacttacgagaactgtctgcaggcactggcagatgtagaagtaaagtatata
gtggaaaggaccatgctagactttccccagcatgtatcctctgacaaagaagtacgagca
gcaagtacagaagcagacaaaagactttctcgttttgatattgagatgagcatgagagga
gatatatttgagagaattgttcatttacaggaaacctgtgatctggggaagataaaacct
gaggccagacgatacttggaaaagtcaattaaaatggggaaaagaaatgggctccatctt
cctgaacaagtacagaatgaaatcaaatcaatgaagaaaagaatgagtgagctatgtatt
gattttaacaaaaacctcaatgaggatgataccttccttgtattttccaaggctgaactt
ggtgctcttcctgatgatttcattgacagtttagaaaagacagatgatgacaagtataaa
attaccttaaaatatccacactatttccctgtcatgaagaaatgttgtatccctgaaacc
agaagaaggatggaaatggcttttaatacaaggtgcaaagaggaaaacaccataattttg
cagcagctactcccactgcgaaccaaggtggccaaactactcggttatagcacacatgct
gacttcgtccttgaaatgaacactgcaaagagcacaagccgcgtaacagcctttctagat
gatttaagccagaagttaaaacccttgggtgaagcagaacgagagtttattttgaatttg
aagaaaaaggaatgcaaagacaggggttttgaatatgatgggaaaatcaatgcctgggat
ctatattactacatgactcagacagaggaactcaagtattccatagaccaagagttcctc
aaggaatacttcccaattgaggtggtcactgaaggcttgctgaacacctaccaggagttg
ttgggactttcatttgaacaaatgacagatgctcatgtttggaacaagagtgttacactt
tatactgtgaaggataaagctacaggagaagtattgggacagttctatttggacctctat
ccaagggaaggaaaatacaatcatgcggcctgcttcggtctccagcctggctgccttctg
cctgatggaagccggatgatggcagtggctgccctcgtggtgaacttctcacagccagtg
gcaggtcgtccctctctcctgagacacgacgaggtgaggacttactttcatgagtttggt
cacgtgatgcatcagatttgtgcacagactgattttgcacgatttagcggaacaaatgtg
gaaactgactttgtagaggtgccatcgcaaatgcttgaaaattgggtgtgggacgtcgat
tccctccgaagattgtcaaaacattataaagatggaagccctattgcagacgatctgctt
gaaaaacttgttgcttctaggctggtcaacacaggtcttctgaccctgcgccagattgtt
ttgagcaaagttgatcagtctcttcataccaacacatcgctggatgctgcaagtgaatat
gccaaatactgctcagaaatattaggagttgcagctactccaggcacaaatatgccagct
acctttggacatttggcagggggatacgatggccaatattatggatatctttggagtgaa
gtattttccatggatatgttttacagctgttttaaaaaagaagggataatgaatccagag
gttggaatgaaatacagaaacctaatcctgaaacctgggggatctctggacggcatggac
atgctccacaatttcttgaaacgtgagccaaaccaaaaagcgttcctaatgagtagaggc
ctgcatgctccgtga

DBGET integrated database retrieval system