KEGG   Homo sapiens (human): 575Help
Entry
575               CDS       T01001                                 

Gene name
BAI1, GDAIF
Definition
brain-specific angiogenesis inhibitor 1
Orthology
K04596  
brain-specific angiogenesis inhibitor 1
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Class
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 1584 aa AA seqDB search
MRGQAAAPGPVWILAPLLLLLLLLGRRARAAAGADAGPGPEPCATLVQGKFFGYFSAAAV
FPANASRCSWTLRNPDPRRYTLYMKVAKAPVPCSGPGRVRTYQFDSFLESTRTYLGVESF
DEVLRLCDPSAPLAFLQASKQFLQMRRQQPPQHDGLRPRAGPPGPTDDFSVEYLVVGNRN
PSRAACQMLCRWLDACLAGSRSSHPCGIMQTPCACLGGEAGGPAAGPLAPRGDVCLRDAV
AGGPENCLTSLTQDRGGHGATGGWKLWSLWGECTRDCGGGLQTRTRTCLPAPGVEGGGCE
GVLEEGRQCNREACGPAGRTSSRSQSLRSTDARRREELGDELQQFGFPAPQTGDPAAEEW
SPWSVCSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSL
CSSTCGRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSACS
ASCSQGRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGSCSVTCGA
GSQRRERVCSGPFFGGAACQGPQDEYRQCGTQRCPEPHEICDEDNFGAVIWKETPAGEVA
AVRCPRNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGE
GVSEVIQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDVQNFVQILSNLL
AEENRDKWEEAQLAGPNAKELFRLVEDFVDVIGFRMKDLRDAYQVTDNLVLSIHKLPASG
ATDISFPMKGWRATGDWAKVPEDRVTVSKSVFSTGLTEADEASVFVVGTVLYRNLGSFLA
LQRNTTVLNSKVISVTVKPPPRSLRTPLEIEFAHMYNGTTNQTCILWDETDVPSSSAPPQ
LGPWSWRGCRTVPLDALRTRCLCDRLSTFAILAQLSADANMEKATLPSVTLIVGCGVSSL
TLLMLVIIYVSVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHF
FFLSSFCWVLTEAWQSYMAVTGHLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTM
NYCWLSLEGGLLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSC
VVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVV
DRQEEGNGDSGGSFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPE
EEKLKLAHAKGPPTNFNSLPANVSKLHLHGSPRYPGGPLPDFPNHSLTLKRDKAPKSSFV
GDGDIFKKLDSELSRAQEKALDTSYVILPTATATLRPKPKEEPKYSIHIDQMPQTRLIHL
STAPEASLPARSPPSRQPPSGGPPEAPPAQPPPPPPPPPPPPQQPLPPPPNLEPAPPSLG
DPGEPAAHPGPSTGPSTKNENVATLSVSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLN
RKLQHAAEKDKEVLGPDSKPEKQQTPNKRPWESLRKAHGTPTWVKKELEPLQPSPLELRS
VEWERSGATIPLVGQDIIDLQTEV
NT seq 4755 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccaggccgccgccccgggccccgtctggatcctcgccccgctgctactgctg
ctgctgctgctgggacgccgcgcgcgggcggccgccggagcagacgcggggcccgggccc
gagccgtgcgccacgctggtgcagggaaagttcttcggctacttctccgcggccgccgtg
ttcccggccaacgcctcgcgctgctcctggacgctacgcaacccggacccgcggcgctac
actctctacatgaaggtggccaaggcgcccgtgccctgcagcggccccggccgcgtgcgc
acctaccagttcgactccttcctcgagtccacgcgcacctacctgggcgtggagagcttc
gacgaggtgctgcggctctgcgacccctccgcacccctggccttcctgcaggccagcaag
cagttcctgcagatgcggcgccagcagccgccccagcacgacgggctccggccccgggcc
gggccgccgggccccaccgacgacttctccgtggagtacctggtggtggggaaccgcaac
cccagccgtgccgcctgccagatgctgtgccgctggctggacgcgtgtctggccggtagt
cgcagctcgcacccctgcgggatcatgcagaccccctgcgcctgcctgggcggcgaggcg
ggcggccctgccgcgggacccctggccccccgcggggatgtctgcttgagagatgcggtg
gctggtggccctgaaaactgcctcaccagcctgacccaggaccggggcgggcacggcgcc
acaggcggctggaagctgtggtccctgtggggcgaatgcacgcgggactgcgggggaggc
ctccagacgcggacgcgcacctgcctgcccgcgccgggcgtggagggcggcggctgcgag
ggggtgctggaggagggtcgccagtgcaaccgcgaggcctgcggccccgctgggcgcacc
agctcccggagccagtccctgcggtccacagatgcccggcggcgcgaggagctgggggac
gagctgcagcagtttgggttcccagccccccagaccggtgacccagcagccgaggagtgg
tccccgtggagcgtgtgctccagcacctgcggcgagggctggcagacccgcacgcgcttc
tgcgtgtcctcctcctacagcacgcagtgcagcggacccctgcgcgagcagcggctgtgc
aacaactctgccgtgtgcccagtgcatggtgcctgggatgagtggtcgccctggagcctc
tgctccagcacctgtggccgtggctttcgggatcgcacgcgcacctgcaggcccccccag
tttgggggcaacccctgtgagggccctgagaagcaaaccaagttctgcaacattgccctg
tgccctggccgggcagtggatggaaactggaatgagtggtcgagctggagcgcctgctcc
gccagctgctcccagggccgacagcagcgcacgcgtgaatgcaacgggccttcctacggg
ggtgcggagtgccagggccactgggtggagacccgagactgcttcctgcagcagtgccca
gtggatggcaagtggcaggcctgggcgtcatggggcagttgcagcgtcacgtgtggggct
ggcagccagcgacgggagcgtgtctgctctgggcccttcttcgggggagcagcctgccag
ggcccccaggatgagtaccggcagtgcggcacccagcggtgtcccgagccccatgagatc
tgtgatgaggacaactttggtgctgtgatctggaaggagaccccagcgggagaggtggct
gctgtccggtgtccccgcaacgccacaggactcatcctgcgacggtgtgagctggacgag
gaaggcatcgcctactgggagccccccacctacatccgctgtgtttccattgactacaga
aacatccagatgatgacccgggagcacctggccaaggctcagcgagggctgcctggggag
ggggtctcggaggtcatccagacactggtggagatctctcaggacgggaccagctacagt
ggggacctgctgtccaccatcgatgtcctgaggaacatgacagagattttccggagagcg
tactacagccccacccctggggacgtacagaactttgtccagatccttagcaacctgttg
gcagaggagaatcgggacaagtgggaggaggcccagctggcgggccccaacgccaaggag
ctgttccggctggtggaggactttgtggacgtcatcggcttccgcatgaaggacctgagg
gatgcataccaggtgacagacaacctggttctcagcatccataagctcccagccagcgga
gccactgacatcagcttccccatgaagggctggcgggccacgggtgactgggccaaggtg
ccagaggacagggtcactgtgtccaagagtgtcttctccacggggctgacagaggccgat
gaagcatccgtgtttgtggtgggcaccgtgctctacaggaacctgggcagcttcctggcc
ctgcagaggaacacgaccgtcctgaattctaaggtgatctccgtgactgtgaaacccccg
cctcgctccctgcgcacacccttggagatcgagtttgcccacatgtataatggcaccacc
aaccagacctgtatcctgtgggatgagacggatgtaccctcctcctccgcccccccgcag
ctcgggccctggtcgtggcgcggctgccgcacggtgcccctcgacgccctccggacgcgc
tgcctctgtgaccggctctccaccttcgccatcttagcccagctcagcgccgacgcgaac
atggagaaggcgactctgccgtcggtgacgctcatcgtgggctgtggcgtgtcctctctc
accctgctcatgctggtcatcatctacgtgtccgtgtggaggtacattcgctcagagcgt
tctgtcatcctcatcaacttctgcctgtccatcatctcctccaatgccctcatcctcatc
gggcagacccagacccgcaacaaggtggtgtgcacgctggtggccgccttcctgcacttc
ttcttcctgtcctccttctgctgggtgctcaccgaggcctggcagtcctacatggcggtg
acgggccacctccggaaccgcctcatccgcaagcgcttcctctgcctgggctgggggctc
cctgcactggttgtggccatttctgtgggattcaccaaggccaaagggtacagcaccatg
aactactgctggctctccctggaggggggactgctctatgccttcgtgggacctgccgct
gccgttgtgctggtgaacatggtcattgggatcctggtgttcaacaagctcgtgtccaaa
gacggcatcacggacaagaagctgaaggagcgggcaggggcctccctgtggagctcctgc
gtggtgctgccgctgctggcgctgacctggatgtcggctgtgctcgccgtcaccgaccgc
cgctccgccctcttccagatcctcttcgctgtcttcgactcgctggagggcttcgtcatc
gtcatggtgcactgtatcctccgtagagaggtccaggacgctgtgaaatgccgtgtggtt
gaccggcaggaggagggcaacggggactcagggggctccttccagaacggccacgcccag
ctcatgaccgacttcgagaaggacgtggatctggcctgtagatcagtgctgaacaaggac
atcgcggcctgccgcactgccaccatcacgggcacactgaagcggccgtctctgcccgag
gaggagaagctgaagctggcccatgccaaggggccgcccaccaatttcaacagcctgccg
gccaacgtgtccaagctgcacctgcacggctcaccccgctatcccggcgggcccctgccc
gacttccccaaccactcactgaccctcaagagggacaaggcgcccaagtcctccttcgtc
ggtgacggggacatcttcaagaagctggactcggagctgagccgggcccaggagaaggct
ctggacacgagctacgtgatcctgcccacggccacggccacgctgcggcccaagcccaag
gaggagcccaagtacagcatccacattgaccagatgccgcagacccgcctcatccacctc
agcacggcccccgaggccagcctccccgcccgcagcccgccctcccgccagccccccagc
ggcgggccccccgaggcaccccctgcccagcccccaccgcctccgcccccaccgccacca
cctccccagcagcccctgcccccaccgcccaatctggagccggcaccccccagcctgggg
gatcccggggagcctgccgcccatccgggacccagcacggggcccagcaccaagaacgag
aatgtcgccaccttgtctgtgagctccctggagcggcggaagtcgcggtatgcagaactg
gactttgagaagatcatgcacacccggaagcggcaccaagacatgttccaggacctgaac
cggaagctgcagcacgcagcggagaaggacaaggaggtgctggggccggacagcaagccg
gaaaagcagcagacgcccaacaagaggccctgggagagcctccggaaagcccacgggacg
cccacgtgggtgaagaaggagctggagccgctgcagccgtcgccgctggagcttcgcagc
gtggagtgggagaggtcgggcgccacgatcccgctggtgggccaggacatcatcgacctc
cagaccgaggtctga

DBGET integrated database retrieval system