KEGG   Homo sapiens (human): 57506Help
Entry
57506             CDS       T01001                                 

Gene name
MAVS, CARDIF, IPS-1, IPS1, VISA
Definition
mitochondrial antiviral signaling protein
Orthology
K12648  
mitochondrial antiviral-signaling protein
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
20p13
AA seq 399 aa AA seqDB search
MPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTE
LGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGL
ASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVST
VPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDG
SSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAI
SASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKF
QEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccaggagacccaggcgccagagtccccaggagagaattcagagcaagccctg
cagacgctcagccccagagccatcccaaggaatccagatggtggccccctggagtcctcc
tctgacctggcagccctcagccctctgacctccagcgggcatcaggagcaggacacagaa
ctgggcagtacccacacagcaggtgcgacctccagcctcacaccatcccgtgggcctgtg
tctccatctgtctccttccagcccctggcccgttccacccccagggcaagccgcttgcct
ggacccacagggtcagttgtatctactggcacctccttctcctcctcatcccctggcttg
gcctctgcaggggctgcagagggtaaacagggtgcagagagtgaccaggccgagcctatc
atctgctccagtggggcagaggcacctgccaactctctgccctccaaagtgcctaccacc
ttgatgcctgtgaacacagtggccctgaaagtgcctgccaacccagcatctgtcagcaca
gtgccctccaagttgccaactagctcaaagccccctggtgcagtgccttctaatgcgctc
accaatccagcaccatccaaattgcccatcaactcaacccgtgctggcatggtgccatcc
aaagtgcctactagcatggtgctcaccaaggtgtctgccagcacagtccccactgacggg
agcagcagaaatgaggagaccccagcagctccaacacccgccggcgccactggaggcagc
tcagcctggctagacagcagctctgagaataggggccttgggtcggagctgagtaagcct
ggcgtgctggcatcccaggtagacagcccgttctcgggctgcttcgaggatcttgccatc
agtgccagcacctccttgggcatggggccctgccatggcccagaggagaatgagtataag
tccgagggcacctttgggatccacgtggctgagaaccccagcatccagctcctggagggc
aaccctgggccacctgcggacccggatggcggccccaggccacaagccgaccggaagttc
caggagagggaggtgccatgccacaggccctcacctggggctctgtggctccaggtggct
gtgacaggggtgctggtagtcacactcctggtggtgctgtaccggcggcgtctgcactag

DBGET integrated database retrieval system