KEGG   Homo sapiens (human): 57506Help
Entry
57506             CDS       T01001                                 

Gene name
MAVS, CARDIF, IPS-1, IPS1, VISA
Definition
(RefSeq) mitochondrial antiviral signaling protein
  KO
K12648  
mitochondrial antiviral-signaling protein
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    57506 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    57506 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    57506 (MAVS)
 Human Diseases
  Infectious diseases
   05162 Measles
    57506 (MAVS)
   05164 Influenza A
    57506 (MAVS)
   05161 Hepatitis B
    57506 (MAVS)
   05160 Hepatitis C
    57506 (MAVS)
   05168 Herpes simplex infection
    57506 (MAVS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p13
AA seq 540 aa AA seqDB search
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPP
TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP
SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLE
GNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgctgaagacaagacctataagtatatctgccgcaatttcagcaatttttgc
aatgtggatgttgtagagattctgccttacctgccctgcctcacagcaagagaccaggat
cgactgcgggccacctgcacactctcagggaaccgggacaccctctggcatctcttcaat
acccttcagcggcggcccggctgggtggagtacttcattgcggcactgaggggctgtgag
ctagttgatctcgcggacgaagtggcctctgtctaccagagctaccagcctcggacctcg
gaccgtcccccagacccactggagccaccgtcacttcctgctgagaggccagggcccccc
acacctgctgcggcccacagcatcccctacaacagctgcagagagaaggagccaagttac
cccatgcctgtccaggagacccaggcgccagagtccccaggagagaattcagagcaagcc
ctgcagacgctcagccccagagccatcccaaggaatccagatggtggccccctggagtcc
tcctctgacctggcagccctcagccctctgacctccagcgggcatcaggagcaggacaca
gaactgggcagtacccacacagcaggtgcgacctccagcctcacaccatcccgtgggcct
gtgtctccatctgtctccttccagcccctggcccgttccacccccagggcaagccgcttg
cctggacccacagggtcagttgtatctactggcacctccttctcctcctcatcccctggc
ttggcctctgcaggggctgcagagggtaaacagggtgcagagagtgaccaggccgagcct
atcatctgctccagtggggcagaggcacctgccaactctctgccctccaaagtgcctacc
accttgatgcctgtgaacacagtggccctgaaagtgcctgccaacccagcatctgtcagc
acagtgccctccaagttgccaactagctcaaagccccctggtgcagtgccttctaatgcg
ctcaccaatccagcaccatccaaattgcccatcaactcaacccgtgctggcatggtgcca
tccaaagtgcctactagcatggtgctcaccaaggtgtctgccagcacagtccccactgac
gggagcagcagaaatgaggagaccccagcagctccaacacccgccggcgccactggaggc
agctcagcctggctagacagcagctctgagaataggggccttgggtcggagctgagtaag
cctggcgtgctggcatcccaggtagacagcccgttctcgggctgcttcgaggatcttgcc
atcagtgccagcacctccttgggcatggggccctgccatggcccagaggagaatgagtat
aagtccgagggcacctttgggatccacgtggctgagaaccccagcatccagctcctggag
ggcaaccctgggccacctgcggacccggatggcggccccaggccacaagccgaccggaag
ttccaggagagggaggtgccatgccacaggccctcacctggggctctgtggctccaggtg
gctgtgacaggggtgctggtagtcacactcctggtggtgctgtaccggcggcgtctgcac
tag

DBGET integrated database retrieval system