KEGG   Homo sapiens (human): 57510Help
Entry
57510             CDS       T01001                                 

Gene name
XPO5, exp5
Definition
exportin 5
Orthology
K14289  
exportin-5
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 1204 aa AA seqDB search
MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQV
AIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIV
VEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTLAGYIDWVSM
SHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVN
SCSAVGTGEGSLCSVFSPSFVQWEAMTLFLESVITQMFRTLNREEIPVNDGIELLQMVLN
FDTKDPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNV
RRHACSSIIKMCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFK
NYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVGTDQKSCDPGLEDPCGLNRAR
MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALI
RTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLV
LFCPPEHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQ
LVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMK
HEDVCTALLITAFNSLAWKDTLSCQRTTSQLCWPLLKQVLSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNDGGGLAT
IFEP
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatcaagtaaacgcgctgtgcgagcagctggtgaaagcggtgacggtcatg
atggaccccaactccacccagcgctaccggctggaagccctcaagttttgtgaggagttt
aaagaaaagtgtcctatctgtgtcccctgtggcttgaggttggctgagaaaacacaagtt
gccatcgtcagacattttggccttcagatcctggaacacgttgtcaagtttcggtggaac
ggcatgtctcgattggagaaggtgtatctgaagaacagtgtcatggagctgattgcaaat
ggaacattgaacattttggaagaggagaaccatattaaagatgctctgtctcgaattgta
gtggaaatgatcaagcgagagtggccacagcattggcctgacatgctaatagaattggac
actctttccaaacaaggggaaacacagacagaattggtgatgtttatccttttgcgactg
gcagaggatgtagtgacttttcagacacttccccctcaaagaagaagggacatccagcaa
acattaacccagaacatggaaaggatcttcagttttctgcttaacacacttcaagaaaat
gtaaacaagtatcagcaagtgaagacagatacttctcaggagtcaaaggcgcaagcaaac
tgtcgagtaggagttgcagcactgaatactctagcaggctatattgactgggtgtctatg
agtcacatcactgctgaaaactgtaaactcctggagatactgtgtttgctgttgaatgaa
caggaacttcagttgggagccgctgagtgtcttctcattgcagtcagcagaaaaggcaag
ttggaagaccggaagcccttgatggtcttatttggagatgttgccatgcattatatactc
tccgccgcacagactgctgatggaggaggtttggtagaaaaacactacgtctttctgaag
aggctctgtcaggtgttgtgtgcgctgggcaatcagctgtgtgcattgctgggtgcagat
tctgatgtagaaacaccatcaaactttggaaaatacctggaatcttttcttgctttcaca
acccatccaagtcagtttctacgctcttcaactcagatgacttggggagccctcttcagg
catgaaatcctgtcccgtgatcctttgctattagcaataataccaaaatatcttcgtgct
tccatgactaacttggtcaagatgggctttccttctaaaacagacagccctagctgtgaa
tattctcggtttgattttgatagcgatgaggacttcaatgctttcttcaactcctcccga
gcacaacaaggagaggtgatgaggttggcatgtcgtttggatcccaaaactagcttccag
atggctggggagtggctaaagtatcaactatcaacttttcttgatgctggttctgtgaat
tcttgttctgcagttggaactggagaaggaagcctctgttccgtcttctcaccttcattc
gtgcagtgggaagccatgactctttttttggaaagtgttatcacccagatgtttcgaaca
ctaaatagagaagaaattcctgttaatgatggaatagagctattgcagatggttctgaac
tttgataccaaggatcccctcatcctgtcctgcgtccttactaatgtctctgcactcttt
ccatttgtcacctacagaccagagttcctgccccaggtcttctctaagctattttcatct
gtcacttttgaaactgttgaagaaagtaaggcccccagaacccgggcagtgaggaatgtg
aggaggcatgcttgttcctccatcatcaagatgtgtcgtgactacccccagcttgtgctg
cccaattttgacatgctttataaccatgtgaagcaactcctctccaatgagctactcctg
acacaaatggagaagtgtgccctcatggaagccctggttctcattagcaaccaatttaag
aactacgagcgtcagaaggtgttcctagaggagctgatggcaccagtggccagcatctgg
ctttctcaagacatgcacagagtgctgtcagatgttgatgctttcattgcgtatgtgggt
acagatcagaagagctgtgacccaggcctggaggatccgtgtggcttaaaccgtgcacga
atgagcttttgtgtatacagcattctgggtgtggtgaaacgaacttgctggcccactgac
ctagaagaggccaaagctgggggatttgtggtgggttatacatccagtggaaatccaatc
ttccgtaacccctgcacagagcagattctgaaacttcttgacaatttgcttgcgcttata
agaacccacaatacattatatgcaccagaaatgctagccaaaatggcagagcctttcacc
aaggctctggatatgcttgacgcggaaaaatctgctatattaggattacctcaacctctc
ttggaactcaatgactctcctgtcttcaaaaccgtcttggaaagaatgcagcgtttcttc
tctaccctctatgaaaactgttttcatatcctagggaaggcaggcccttccatgcagcaa
gacttctatactgtggaggaccttgctacccagcttctcagctcagcctttgtcaacttg
aacaatattcctgactaccgactcagacccatgcttcgtgtctttgtaaagcctctggtg
ctcttctgtcccccagagcactatgaagccctggtatcccccatcctcggacctcttttc
acctacctccatatgaggctttctcagaaatggcaagttatcaaccaaaggagcctgctg
tgtggagaagatgaggctgcagatgaaaacccagagtctcaagagatgctggaggagcaa
ctggtgaggatgttaacccgagaagtcatggacctaatcacggtttgctgtgtttcaaag
aagggtgctgaccacagtagtgctcccccagcagatggagacgatgaagaaatgatggcc
acagaggtcaccccctcagctatggcagagcttacagacctgggcaaatgtctgatgaag
catgaggatgtttgtacagcgctattaattacagccttcaattccctggcctggaaagat
actctgtcctgccagaggacaacctcacagctctgctggcctctcctcaaacaagtgctg
tcagggacactgctcgcagatgcagttacgtggcttttcaccagtgtgctgaaaggctta
cagatgcacgggcagcacgacgggtgcatggcttccctggtccatctggccttccagata
tacgaggcactgcgccccaggtacctggagataagagctgtaatggagcaaatccctgaa
atacagaaggactcactggaccagtttgactgcaagcttttaaacccctccctgcagaaa
gtggctgacaagcgccgaaaggaccaattcaaacgcctcattgctggttgcattgggaaa
cccttgggagagcagttccgaaaagaagttcacattaagaatcttccctcacttttcaaa
aaaacaaagccaatgctggagacggaggtgctggacaatgatgggggtggcctggccacc
atctttgaaccctga

DBGET integrated database retrieval system