KEGG   Homo sapiens (human): 57521Help
Entry
57521             CDS       T01001                                 

Gene name
RPTOR, KOG1, Mip1
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    57521 (RPTOR)
   04152 AMPK signaling pathway
    57521 (RPTOR)
   04150 mTOR signaling pathway
    57521 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    57521 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    57521 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    57521 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    57521 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaaatgctgcaatcgcctcttctgggcctgggggaggaagatgaggctgat
cttacagactggaacctacctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgttggtgtggaccctcccgatgtggtgaagaccacgccc
tgtgcacgcttggaatgctggatcgatcctctgtcgatgggtcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctctgcacgtccttacgtcgcaac
gccaaggaggagcgagtcctctttcactacaatggccacggggtgccccggcccacagtc
aacggggaggtctgggtcttcaacaagaactacacgcagtacatccctctgtccatatat
gacctgcagacgtggatgggcagcccgtcgatcttcgtctacgactgctccaatgctggc
ttgatcgtcaagtccttcaagcagttcgcactacagcgggagcaggagctggaggtagct
gcaatcaacccaaatcaccctcttgctcagatgcctttgcctccgtcgatgaaaaactgc
atccagctggcagcctgcgaggccaccgagctgctgcccatgatccccgacctcccggct
gacctattcacctcctgcctcaccacccccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgtcagtctggtgcctggcgtcacactggatttgatagaaaagatccctggc
cgcctgaacgacaggaggacgcccctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcgtggaacgtgctcccccgggatctcttccaaaagctcttcagacaggac
ttgctggtggctagtctgtttcgaaattttttattggcggaaaggattatgaggtcgtat
aactgcactcccgtcagcagcccgcgtctgccgcccacgtacatgcacgccatgtggcaa
gcctgggacctggctgttgacatctgtctgtctcagctgccgacgatcatcgaggaaggc
actgcgtttcggcacagcccgttcttcgccgagcagctgaccgcattccaggtgtggctc
accatgggcgtggagaaccgaaacccacccgaacagctgcccatcgtcctgcaggtgctg
ttaagccaagtgcaccggctgagagcattggacttgcttggaagatttttggacctgggt
ccctgggcagtgagcctggccttgtctgtcggcatcttcccctacgtgctgaagctgctc
cagagctcggcccgagagctgcggccacttctcgttttcatctgggccaagatcctcgca
gtggacagctcgtgccaagcggacctcgtgaaggacaacggccacaagtacttcctgtcg
gtcctggcggacccctacatgccagctgaacaccggaccatgacggctttcattctcgcc
gtgatcgtcaacagctatcacacggggcaggaagcctgccttcagggaaacctcattgcc
atctgcctggagcagctcaacgacccgcaccccttgctgcgccagtgggtggccatctgc
ctcggcaggatctggcagaacttcgactcggcgaggtggtgcggcgtgagggacagcgct
catgagaagctctacagcctcctctccgaccccattcccgaggtccgctgcgcagcggtc
ttcgcccttggcacgttcgtgggcaactctgcagagaggacggaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtccgg
aaggagctggtggtggctctgagtcatcttgtggttcagtatgaaagcaatttctgcacc
gtggccctgcagttcatagaagaggaaaagaactacgccttgccttctccagcaaccaca
gagggagggagtttgaccccagtgcgagacagcccgtgcacccccagacttcgttctgtg
agctcctatggaaacatccgtgctgtcgccacagccaggagcctcaacaaatctttgcag
aacctgagtttgacagaggaatctggtggcgcggtggcgttctcccccggaaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaatgaggagcatatcctgtcc
ttcgagaccatcgacaagatgcgccgcgccagctcctactcctccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagtcctgctgcacctggctgct
gacccctatccagaggtctcggacgtggccatgaaagtactcaacagcatcgcctacaag
gccaccgtgaacgcccggccgcagcgcgtcctggacacctcctccctcacgcagtcggcc
cccgccagccccaccaacaagggcgtgcacatccaccaggcggggggctcccctccggcg
tccagcaccagcagctccagcctgaccaacgatgtggccaagcagccggtcagccgagac
ttgccttctggccggccgggcaccacaggccccgctggggcgcagtacacccctcactcc
caccagttcccccggacacggaagatgttcgacaagggcccagagcagactgcggacgac
gcggacgatgctgctggacacaaaagtttcatctccgccacggtgcagacggggttctgc
gactggagcgcccgctattttgcccagcccgtcatgaagatcccagaagagcacgacctg
gagagtcagatccgcaaggagcgggagtggcggttcctgcgaaacagccgtgtcaggagg
caggcccagcaagtcattcagaagggcattacgagattggacgaccaaatatttctgaac
aggaaccccggcgtcccctctgtggtgaaattccaccccttcacgccgtgcatcgccgta
gccgacaaggacagcatctgcttttgggactgggagaaaggggagaagctggattatttc
cacaatgggaaccctcggtacacgagggtcactgccatggagtatctgaacggccaggac
tgctcgcttctgctgacggccacagacgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaacccagagatggtgaccgcgtggcaggggctctcggacatgctgcca
acgacgcgaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcaggagacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccctacgggcgcagacagctgtgtgacgagtctgtcctgtgattcccaccgctcactc
atcgtggctggcctcggtgacggctccatccgcgtctacgacagaaggatggcactcagc
gaatgccgcgtcatgacgtaccgggagcacacagcctgggtggtgaaggcctccctgcag
aagcgtcccgacggccacatcgtgagtgtgagcgtcaatggagatgtgcgcatctttgat
ccccggatgcctgagtcggtaaatgtgcttcagatcgtgaaggggctgacggccctggac
atccacccccaggcggacctgatcgcatgtggctccgtcaatcagttcaccgccatctac
aacagcagcggagagctcatcaacaacatcaagtactacgacggcttcatgggccagcgg
gtcggcgccatcagctgcctggccttccacccgcactggcctcacctggccgtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system