KEGG   Homo sapiens (human): 57521Help
Entry
57521             CDS       T01001                                 

Gene name
RPTOR, KOG1, Mip1
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
hsa  Homo sapiens (human)
Pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    57521 (RPTOR)
   04152 AMPK signaling pathway
    57521 (RPTOR)
   04150 mTOR signaling pathway
    57521 (RPTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    57521 (RPTOR)
   04136 Autophagy - other eukaryotes
    57521 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    57521 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    57521 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    57521 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    57521 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8N122(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.3
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaaatgctgcaatcgcctcttctgggcctgggggaggaagatgaggctgat
cttacagactggaacctacctttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgttggtgtggaccctcccgatgtggtgaagaccacgccc
tgtgcacgcttggaatgctggatcgatcctctgtcgatgggtcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccaagggcccggtacaag
cagagccttgacccaactgtggatgaagtcaagaagctctgcacgtccttacgtcgcaac
gccaaggaggagcgagtcctctttcactacaatggccacggggtgccccggcccacagtc
aacggggaggtctgggtcttcaacaagaactacacgcagtacatccctctgtccatatat
gacctgcagacgtggatgggcagcccgtcgatcttcgtctacgactgctccaatgctggc
ttgatcgtcaagtccttcaagcagttcgcactacagcgggagcaggagctggaggtagct
gcaatcaacccaaatcaccctcttgctcagatgcctttgcctccgtcgatgaaaaactgc
atccagctggcagcctgcgaggccaccgagctgctgcccatgatccccgacctcccggct
gacctattcacctcctgcctcaccacccccatcaagatcgccctgcgctggttttgcatg
cagaaatgtgtcagtctggtgcctggcgtcacactggatttgatagaaaagatccctggc
cgcctgaacgacaggaggacgcccctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcgtggaacgtgctcccccgggatctcttccaaaagctcttcagacaggac
ttgctggtggctagtctgtttcgaaattttttattggcggaaaggattatgaggtcgtat
aactgcactcccgtcagcagcccgcgtctgccgcccacgtacatgcacgccatgtggcaa
gcctgggacctggctgttgacatctgtctgtctcagctgccgacgatcatcgaggaaggc
actgcgtttcggcacagcccgttcttcgccgagcagctgaccgcattccaggtgtggctc
accatgggcgtggagaaccgaaacccacccgaacagctgcccatcgtcctgcaggtgctg
ttaagccaagtgcaccggctgagagcattggacttgcttggaagatttttggacctgggt
ccctgggcagtgagcctggccttgtctgtcggcatcttcccctacgtgctgaagctgctc
cagagctcggcccgagagctgcggccacttctcgttttcatctgggccaagatcctcgca
gtggacagctcgtgccaagcggacctcgtgaaggacaacggccacaagtacttcctgtcg
gtcctggcggacccctacatgccagctgaacaccggaccatgacggctttcattctcgcc
gtgatcgtcaacagctatcacacggggcaggaagcctgccttcagggaaacctcattgcc
atctgcctggagcagctcaacgacccgcaccccttgctgcgccagtgggtggccatctgc
ctcggcaggatctggcagaacttcgactcggcgaggtggtgcggcgtgagggacagcgct
catgagaagctctacagcctcctctccgaccccattcccgaggtccgctgcgcagcggtc
ttcgcccttggcacgttcgtgggcaactctgcagagaggacggaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtccgg
aaggagctggtggtggctctgagtcatcttgtggttcagtatgaaagcaatttctgcacc
gtggccctgcagttcatagaagaggaaaagaactacgccttgccttctccagcaaccaca
gagggagggagtttgaccccagtgcgagacagcccgtgcacccccagacttcgttctgtg
agctcctatggaaacatccgtgctgtcgccacagccaggagcctcaacaaatctttgcag
aacctgagtttgacagaggaatctggtggcgcggtggcgttctcccccggaaacctcagc
accagcagcagcgccagcagcaccctgggcagccccgagaatgaggagcatatcctgtcc
ttcgagaccatcgacaagatgcgccgcgccagctcctactcctccctcaactccctcatc
ggagtttcctttaacagtgtttacactcagatttggagagtcctgctgcacctggctgct
gacccctatccagaggtctcggacgtggccatgaaagtactcaacagcatcgcctacaag
gccaccgtgaacgcccggccgcagcgcgtcctggacacctcctccctcacgcagtcggcc
cccgccagccccaccaacaagggcgtgcacatccaccaggcggggggctcccctccggcg
tccagcaccagcagctccagcctgaccaacgatgtggccaagcagccggtcagccgagac
ttgccttctggccggccgggcaccacaggccccgctggggcgcagtacacccctcactcc
caccagttcccccggacacggaagatgttcgacaagggcccagagcagactgcggacgac
gcggacgatgctgctggacacaaaagtttcatctccgccacggtgcagacggggttctgc
gactggagcgcccgctattttgcccagcccgtcatgaagatcccagaagagcacgacctg
gagagtcagatccgcaaggagcgggagtggcggttcctgcgaaacagccgtgtcaggagg
caggcccagcaagtcattcagaagggcattacgagattggacgaccaaatatttctgaac
aggaaccccggcgtcccctctgtggtgaaattccaccccttcacgccgtgcatcgccgta
gccgacaaggacagcatctgcttttgggactgggagaaaggggagaagctggattatttc
cacaatgggaaccctcggtacacgagggtcactgccatggagtatctgaacggccaggac
tgctcgcttctgctgacggccacagacgatggtgccatcagggtctggaagaattttgct
gatttggaaaagaacccagagatggtgaccgcgtggcaggggctctcggacatgctgcca
acgacgcgaggagctgggatggtggtggactgggagcaggagaccggcctcctcatgagc
tcaggagacgtgcggatcgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccctacgggcgcagacagctgtgtgacgagtctgtcctgtgattcccaccgctcactc
atcgtggctggcctcggtgacggctccatccgcgtctacgacagaaggatggcactcagc
gaatgccgcgtcatgacgtaccgggagcacacagcctgggtggtgaaggcctccctgcag
aagcgtcccgacggccacatcgtgagtgtgagcgtcaatggagatgtgcgcatctttgat
ccccggatgcctgagtcggtaaatgtgcttcagatcgtgaaggggctgacggccctggac
atccacccccaggcggacctgatcgcatgtggctccgtcaatcagttcaccgccatctac
aacagcagcggagagctcatcaacaacatcaagtactacgacggcttcatgggccagcgg
gtcggcgccatcagctgcctggccttccacccgcactggcctcacctggccgtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system