KEGG   Homo sapiens (human): 5753Help
Entry
5753              CDS       T01001                                 

Gene name
PTK6, BRK
Definition
(RefSeq) protein tyrosine kinase 6 (EC:2.7.10.2)
  KO
K08894  
protein tyrosine kinase 6 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5753 (PTK6)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Src family
   5753 (PTK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.3
AA seq 451 aa AA seqDB search
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccgggaccaggctcacctgggccccaagtatgtgggcctctgggacttcaag
tcccggacggacgaggagctgagcttccgcgcgggggacgtcttccacgtggccaggaag
gaggagcagtggtggtgggccacgctgctggacgaggcgggtggggccgtggcccagggc
tatgtgccccacaactacctggccgagagggagacggtggagtcggaaccgtggttcttt
ggctgcatctcccgctcggaagctgtgcgtcggctgcaggccgagggcaacgccacgggc
gccttcctgatcagggtcagcgagaagccgagtgccgactacgtcctgtcggtgcgggac
acgcaggctgtgcggcactacaagatctggcggcgtgccgggggccggctgcacctgaac
gaggcggtgtccttcctcagcctgcccgagcttgtgaactaccacagggcccagagcctg
tcccacggcctgcggctggccgcgccctgccggaagcacgagcctgagcccctgccccat
tgggatgactgggagaggccgagggaggagttcacgctctgcaggaagctggggtccggc
tactttggggaggtcttcgaggggctctggaaagaccgggtccaggtggccattaaggtg
atttctcgagacaacctcctgcaccagcagatgctgcagtcggagatccaggccatgaag
aagctgcggcacaaacacatcctggcgctgtacgccgtggtgtccgtgggggaccccgtg
tacatcatcacggagctcatggccaagggcagcctgctggagctgctccgcgactctgat
gagaaagtcctgcccgtttcggagctgctggacatcgcctggcaggtggctgagggcatg
tgttacctggagtcgcagaattacatccaccgggacctggccgccaggaacatcctcgtc
ggggaaaacaccctctgcaaagttggggacttcgggttagccaggcttatcaaggaggac
gtctacctctcccatgaccacaatatcccctacaagtggacggcccctgaagcgctctcc
cgaggccattactccaccaaatccgacgtctggtcctttgggattctcctgcatgagatg
ttcagcaggggtcaggtgccctacccaggcatgtccaaccatgaggccttcctgagggtg
gacgccggctaccgcatgccctgccctctggagtgcccgcccagcgtgcacaagctgatg
ctgacatgctggtgcagggaccccgagcagagaccctgcttcaaggccctgcgggagagg
ctctccagcttcaccagctacgagaacccgacctga

DBGET integrated database retrieval system