KEGG   Homo sapiens (human): 57538Help
Entry
57538             CDS       T01001                                 

Gene name
ALPK3, MAK, MIDORI
Definition
(RefSeq) alpha kinase 3
  KO
K08868  
alpha-kinase
Organism
hsa  Homo sapiens (human)
Brite
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   57538 (ALPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q25.2
AA seq 1907 aa AA seqDB search
MEVAWLVYVLGQQPLARQGEGQSRLVPGRGLVLWLPGLPRSSPSWPAVDLAPLAPARPRG
PLICHTGHEQAGREPGPGSSTKGPVLHDQDTRCAFLPRPPGPLQTRRYCRHQGRQGSGLG
AGPGAGTWAPAPPGVSKPRCPGRARPGEGQQQVTTARPPAINRGARQPRAGAAAAGRGPG
AGAWRTGEAAASAGPAVGEGGAMGSRRAPSRGWGAGGRSGAGGDGEDDGPVWIPSPASRS
YLLSVRPETSLSSNRLSHPSSGRSTFCSIIAQLTEETQPLFETTLKSRSVSEDSDVRFTC
IVTGYPEPEVTWYKDDTELDRYCGLPKYEITHQGNRHTLQLYRCREEDAAIYQASAQNSK
GIVSCSGVLEVGTMTEYKIHQRWFAKLKRKAAAKLREIEQSWKHEKAVPGEVDTLRKLSP
DRFQRKRRLSGAQAPGPSVPTREPEGGTLAAWQEGETETAQHSGLGLINSFASGEVTTNG
EAAPENGEDGEHGLLTYICDAMELGPQRALKEESGAKKKKKDEESKQGLRKPELEKAAQS
RRSSENCIPSSDEPDSCGTQGPVGVEQVQTQPRGRAARGPGSSGTDSTRKPASAVGTPDK
AQKAPGPGPGQEVYFSLKDMYLENTQAVRPLGEEGPQTLSVRAPGESPKGKAPLRARSEG
VPGAPGQPTHSLTPQPTRPFNRKRFAPPKPKGEATTDSKPISSLSQAPECGAQSLGKAPP
QASVQVPTPPARRRHGTRDSTLQGQAGHRTPGEVLECQTTTAPTMSASSSSDVASIGVST
SGSQGIIEPMDMETQEDGRTSANQRTGSKKNVQADGKIQVDGRTRGDGTQTAQRTRADRK
TQVDAGTQESKRPQSDRSAQKGMMTQGRAETQLETTQAGEKIQEDRKAQADKGTQEDRRM
QGEKGMQGEKGTQSEGSAPTAMEGQSEQEVATSLGPPSRTPKLPPTAGPRAPLNIECFVQ
TPEGSCFPKKPGCLPRSEEAVVTASRNHEQTVLGPLSGNLMLPAQPPHEGSVEQVGGERC
RGPQSSGPVEAKQEDSPFQCPKEERPGGVPCMDQGGCPLAGLSQEVPTMPSLPGTGLTAS
PKAGPCSTPTSQHGSTATFLPSEDQVLMSSAPTLHLGLGTPTQSHPPETMATSSEGACAQ
VPDVEGRTPGPRSCDPGLIDSLKNYLLLLLKLSSTETSGAGGESQVGAATGGLVPSATLT
PTVEVAGLSPRTSRRILERVENNHLVQSAQTLLLSPCTSRRLTGLLDREVQAGRQALAAA
RGSWGPGPSSLTVPAIVVDEEDPGLASEGASEGEGEVSPEGPGLLGASQESSMAGRLGEA
GGQAAPGQGPSAESIAQEPSQEEKFPGEALTGLPAATPEELALGARRKRFLPKVRAAGDG
EATTPEERESPTVSPRGPRKSLVPGSPGTPGRERRSPTQGRKASMLEVPRAEEELAAGDL
GPSPKAGGLDTEVALDEGKQETLAKPRKAKDLLKAPQVIRKIRVEQFPDASGSLKLWCQF
FNILSDSVLTWAKDQRPVGEVGRSAGDEGPAALAIVQASPVDCGVYRCTIHNEHGSASTD
FCLSPEVLSGFISREEGEVGEEIEMTPMVFAKGLADSGCWGDKLFGRLVSEELRGGGYGC
GLRKASQAKVIYGLEPIFESGRTCIIKVSSLLVFGPSSETSLVGRNYDVTIQGCKIQNMS
REYCKIFAAEARAAPGFGEVPEIIPLYLIYRPANNIPYATLEEDLGKPLESYCSREWGCA
EAPTASGSSEAMQKCQTFQHWLYQWTNGSFLVTDLAGVDWKMTDVQIATKLRGYQGLKES
CFPALLDRFASSHQCNAYCELLGLTPLKGPEAAHPQAKAKGSKSPSAGRKGSQLSPQPQK
KGLPSPQGTRKSAPSSKATPQASEPVTTQLLGQPPTQEEGSKAQGMR
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggcttggcttgtctatgtgctgggccaacagccactggcgaggcaaggcgag
ggtcagtcacggctggtgccaggaagagggctggttctttggctccctggtctcccgcgg
tctagcccaagctggccagcggttgacctggctcccctggccccggccaggcctcgtgga
cccctcatatgccacacgggacatgagcaggccggccgggagccgggtcccgggagctcc
acgaaggggcctgtcctccatgaccaggacacccgctgcgccttcctcccgaggcctccc
gggcctctccagacgcggcgctactgcagacaccagggccgccaagggagcggactcgga
gccggccctggggcgggcacatgggccccggcgccccccggcgtctccaagccgcgctgc
ccgggtcgggccaggccaggggagggacagcagcaggtgacgacggcccggccaccggct
ataaataggggcgcgcgtcagccgcgggcgggagcggcggcggcgggcaggggcccgggg
gccggggcctggaggacaggcgaggcagcggcgagtgcggggccggcggtcggggagggc
ggtgccatggggtcgcggagggcccccagccggggctggggcgcgggtgggcggtcgggg
gcggggggcgacggtgaggacgacggccccgtgtggatccccagcccagccagccggagc
tacctgctcagcgtgcggcccgagaccagcttatcaagcaaccggttgtctcaccccagc
tctggaaggagcaccttctgctccatcattgctcagctcacagaggagacccagccgcta
tttgagaccacgctcaagtcccggtctgtgtccgaggacagcgacgtcaggttcacctgc
atcgtcacaggatacccagagccagaggtgacctggtacaaggatgatacggagctggac
cgctactgtggcttgccaaaatatgagatcactcatcagggcaaccgccacacactgcag
ctgtacaggtgtcgagaagaagatgccgccatctaccaggcctctgcccagaacagcaag
ggcattgtgtcctgctcaggggtcctggaggtgggcaccatgactgagtacaagatccac
cagcgctggttcgccaagttgaagcgcaaggctgcggcaaagctgcgcgagatcgagcag
agctggaagcacgagaaggcggtgcctggggaggtcgacactctgcgcaagctcagcccc
gaccgcttccagcgaaagcggcgattgagcggggctcaagcgccgggcccctcggtccct
accagggagcctgagggtgggaccctggcggcttggcaggagggagagactgagactgct
cagcactcaggtttgggcctgatcaacagttttgcttctggagaagtgaccaccaacggg
gaggctgcccccgagaatggagaggacggagagcatggcttgctgacatacatctgtgac
gccatggagctggggcctcagagagccctcaaagaggagagtggggccaagaagaaaaag
aaagatgaggaatccaagcaaggcctgcggaagccagagttagagaaggcagcccaaagc
cgccgttcttcagaaaactgcatccccagctcagacgagcctgactcctgtgggactcag
gggcccgtgggcgtggagcaggttcagacccagcccagaggcagggctgcacgggggcct
gggtcctctggcacagatagtaccaggaagccagcctctgctgtgggcactccagacaag
gcccagaaggcccctggcccaggcccaggccaggaagtgtatttctccttgaaggacatg
tacctggagaacacccaggcagtcaggcctcttggggaagagggaccccagaccctgagt
gtccgggcgcctggggagagtcccaaggggaaggcacccctcagggctagaagcgagggg
gtgcctggcgctcctggccagcccacacactccttgaccccccagccgactaggcctttc
aacagaaagagatttgcccctccaaagcccaaaggagaggccaccactgacagcaagccc
atttcttctctgagtcaagctccagaatgcggggcccagagcttaggaaaggccccacct
caggcctctgtgcaggtgccgacgccccctgcccggcggagacatggcacccgggacagc
acgttgcaggggcaagcaggccacaggactccaggagaggtcctggaatgccagacaacc
acggctcctaccatgtcggccagcagcagctctgatgtagcctccattggggttagcact
tccggaagtcaaggtatcattgaacccatggatatggaaacccaggaggatgggagaaca
tctgctaaccagagaactggaagcaagaagaatgtgcaggcagatgggaagatacaagtg
gatggaaggaccaggggagatggaacacagacagcccagaggacacgtgcagataggaag
acgcaggtggatgctgggacacaagaaagcaagaggccacagtcagacaggagtgcacag
aagggcatgatgacacagggaagggcagagacacagctagaaacaacacaggcaggtgag
aagatacaggaagacaggaaggcccaggcagataagggcacacaggaagacagaaggatg
cagggagagaaggggatgcagggagagaaggggacgcagtcagaggggagcgcgcccaca
gccatggaaggtcagtctgagcaagaggtggcaaccagcctcggcccaccatccagaacc
cccaaactcccacctacagcgggtcctagagctcctctgaatattgaatgttttgtacag
accccagaagggtcttgtttcccaaaaaaacctggttgcctgcccagatctgaggaggca
gtagtaacagcctccaggaaccatgagcaaactgtgctgggtcccctgtcagggaacctc
atgctcccagcacagccgccccatgaggggagtgtggagcaggtgggaggagagagatgc
cgagggccacagtcatcaggcccagtcgaggccaagcaggaggacagcccgttccagtgc
cccaaggaggagcggccagggggagtgccgtgtatggatcagggtggctgtcctctagct
ggcctgagccaggaggtacccacgatgccttctcttcctggaactgggctgacagctagc
ccaaaggcggggccgtgtagcaccccgacttctcagcacgggagcacagccaccttcctg
ccctctgaggatcaggtcctgatgagttctgccccaacactgcacctggggctggggacc
cccactcagagtcacccaccagaaaccatggccaccagcagtgagggggcctgcgcccag
gtaccagatgtggaggggcggaccccaggtccccggagctgtgaccctggcctcatagat
tccctgaagaactacctgcttctgctgctgaagctgtccagcacagagacaagtggagca
gggggagagtcccaggtgggggcagccaccggaggtctggtgccctcagccactctgaca
cccactgtggaagtggctgggcttagtccccggacatcgaggcgcatcctggagcgtgtg
gagaacaaccacctggtgcagagtgcacagaccctgctgctgagcccctgtacctcccgc
cgcctcaccggcctcctggaccgtgaggtgcaggctggccgccaggcccttgctgctgcc
cgaggctcctggggtcctggtcccagctccctcactgtccctgccattgtggtagacgag
gaggaccctgggctggcctcagaaggagccagtgagggtgaaggagaggtttcccctgag
gggcctggcctcctgggggcctctcaggagagcagcatggctggtcgactgggggaggcg
ggtgggcaggcagcccctggacaggggccctcagcagagagcatagcccaggagccctcc
caagaggagaagttcccaggggaggctctgacaggtctcccggcagctacacctgaggaa
ctggctctaggggcccggaggaagagatttctccctaaggtcagagcagcaggagacggg
gaggcaaccacacctgaagaaagggagagccccacggtttccccccgggggcccaggaaa
agcctggtgcctgggtccccagggactccagggcgggagagacgctcccctacgcagggc
agaaaggcgagcatgctggaggtgcctcgggcagaggaggagctggcggcaggagacctg
ggccccagccccaaggccggcggtctggacacagaggtggccctggatgaaggcaagcag
gagacactggccaagcccaggaaagccaaagacctgctgaaagccccacaggtgatccgg
aagattcgggtggagcagtttcctgatgcctccggtagcctgaagctgtggtgccagttt
ttcaacattcttagtgactcagtcttgacatgggccaaggatcagcgcccagtgggcgag
gtgggcaggagcgcaggggatgaggggccggcggccttggccatcgtgcaggcctccccc
gtagactgcggtgtgtatcggtgcaccatccacaatgagcacggctcggcctccaccgac
ttctgcctcagccctgaggtgttgtcaggattcatctccagagaagaaggtgaagttgga
gaagagattgagatgacccctatggtgtttgctaagggtctggctgactctggctgctgg
ggggacaagctctttgggcgactggtaagcgaggagctccgagggggtggatatgggtgt
ggccttcggaaggcctcccaggccaaggtcatctacgggctggaacccatcttcgagtcg
ggccgcacgtgcatcatcaaggtgtccagcctgcttgtgtttgggcccagcagtgagact
tctcttgtgggcagaaactacgacgtcaccatccaggggtgcaagatccagaacatgagt
cgggagtactgcaaaatcttcgcagcagaagcccgggccgcgcctggctttggggaggtg
cctgagatcatcccactgtatctgatctaccggcctgcaaacaatatcccatatgctacc
ctggaggaagacctgggcaagcccctggagtcttactgttctcgggaatggggctgtgct
gaggctccgacagcatctggcagctctgaggccatgcagaaatgccagaccttccaacac
tggctgtatcagtggacaaatggcagcttccttgtcacagacttggcaggggttgactgg
aagatgactgatgtgcagattgctaccaaactccgaggataccagggcctcaaggaaagc
tgcttccctgccctgctggaccggttcgcctcctcccaccagtgcaatgcctactgtgag
ctgctggggctgacacctctcaagggcccggaggcggcccacccccaagccaaagccaaa
ggctctaagagtccatctgctggcaggaaaggctcccagctgagtcctcagccccagaag
aaaggcctccctagtcctcagggcacccggaagagtgctccaagttccaaggccacccct
caggcctcagagccagtcaccactcagttgttgggacagcctcccacccaagaggagggc
tccaaggcccagggcatgcggtag

DBGET integrated database retrieval system